Protein List

Your search: Gene superfamily in [Insulin superfamily] and Protein Type in [Precursor]

Found 7 entries.


ID Name Gene superfamily Organism Sequence
P07893 Con-Ins G1 precursor Insulin superfamily Conus geographus (Geography cone)
MTTSSYFLLMALGLLLYVCQS
SFGNQHTR
TFDTPKHRCGSE
ITNSYMDLCY
RKRNDAGEKRGRASPLWQRRGSLSKLKARAK
RNGAFHLPRDGR
GVVEHCCHRPCSNAEFKKYC
G
P07894 Con-Ins G3 precursor Insulin superfamily Conus geographus (Geography cone)
MTTSFYFLLVALGLLLYVCQS
SFGNQHTR
NSDTPKHRCGSE
LADQYVQLCH
GKRNDAGKKRGRASPLWQRQGFLSMLKAKRN
EAFFLQRDGR
GIVEVCCDNPCTVATLRTFCH
P07889 Con-Ins K1 precursor Insulin superfamily Conus kinoshitai
MTTSSYFLLVALGLLLYVCQSSFG
SPHT
SDSGTTLVRRRLC
GSELVTYLGELCLGN
RKRRGFPSMLKARAKRNEAFLLQRDG
R
GIVEDCCYNDCTDEKLKEYCHTLQ
G
P07890 Con-Ins K2 precursor Insulin superfamily Conus kinoshitai
MTTSSYFLLVALGLLLYVCQSSFG
NPHTRD
SGTTPDRDHSC
GGELVDRLVKLCPSN
RKRRGFPSMLKARAKRNEAFLLQRDG
R
VIVGDCCDNYCTDERLKGYCASLLGL
P07891 Con-Ins T1A precursor Insulin superfamily Conus tulipa (tulip cone)
MTTSFYFLLMALGLLLYVCQS
SFGNQHTR
NSDTPKYRCGSE
IPNSYIDLCF
RKRNDAGKKRGRASPLWQRGGSLSMLKARAK
RNEAFHLQRAHR
GVVEHCCHRPCSNAEFKKFC
G
P07892 Con-Ins T1B precursor Insulin superfamily Conus tulipa (tulip cone)
MTTSFYFLLMALGLLLYVCQS
SFGNQHTR
NSDTPKYRCGSD
IPNSYMDLCF
RKRNDAGKKRGQASPLWQRGGSLSMLKARAK
RNEAFHLQRAHR
GVVEHCCYRPCSNAEFKKFC
G
P07895 Con-Ins T2 precursor Insulin superfamily Conus tulipa (tulip cone)
MTTSFYFLLVALGLLLYVCQS
SFGNQHTR
NSDTPWNRCGSQ
ITDSYRELCPH
KRNDAGKKRGQASPLWQRGGSLSMLKARAK
RNEAFHLQRAHR
GVVEHCCKRACSNAEFMQFC
G