Protein List

Your search: Gene superfamily in [J superfamily] and Protein Type in [Precursor]

Found 30 entries.


ID Name Gene superfamily Organism Sequence
P05891 Bt14.1 precursor J superfamily Conus betulinus
MPSVRSVTCCCLLWMMFSVQLVTS
DLTGTAWLSTHLDARIP
SEENMEVL
CPEMCNEGSGGVACSCSKRRDVVSSFV
RRRKRS
MV
P05892 Bt14.3 precursor J superfamily Conus betulinus
MPSVRSVTCCCLLWMMFSVQLVTP
GSPGTAQLPRDRTAR
AP
AELILETICPHMCGTGIGEPFCNCRNKRDVVSSRII
RRKRS
MAV
P05896 Di14.1 precursor J superfamily Conus distans
MPSVRSVTCCCLLWMMF
FHAFATGMGGCIWTILLFHAYGAH
FPGRIVSARLLSLCWVYRCLLLPVLCLWLFASSASESCSFV
TLYWELVTRCR
P04534 Eu14.1 precursor J superfamily Conus eburneus
MTSVQSVTCCCLLWLMLSLTLVTP
GSPGPAQLPGHRAAR
VP
AEPILEEICPDMCNSGEGEIFCTCGSRQFVVTLPVIE
RKRS
MAV
P05894 Eu14.2 precursor J superfamily Conus eburneus
MPSVRSVTCCCLLWMMFSLTLVTP
GSPGPAQLPGHRAAR
AL
AEPILEEICPDMCNSGEGEIFCACGSRQFVVTLPVIE
RKRS
MAV
P05895 Eu14.3 precursor J superfamily Conus eburneus
MPSVRSVTCCCLLWMMFSLTLVTP
GSPGPAQLPGHRAAR
VP
AEQMMEELCPDMCNRGEGEIICTCVLGRHVVSPSIR
GRKRS
MAV
P01186 Fe14.1 precursor J superfamily Conus ferrugineus
MPSVRSVTCCCLLWMMLSVQLVTP
GSPGTAQLSGHRTAR
SP
GSTICKMACRTGNGHKYPFCNCR
GKRDVVSSSMAV
P01187 Fe14.2 precursor J superfamily Conus ferrugineus
MPSVRSVTCCCLLWMMLSVQLVTP
GSPGTAQLSGQRTAR
SS
GSTVCKMMCRLGYGHLYPSCGCR
GKRDVVSSSMAV
P05783 G14.1 precursor J superfamily Conus geographus (Geography cone)
MTSVQSVTCCCLLWLMLSVQPITP
GSPGPAQLSRER
SFRFI
PGGIKEIACHRYCAKGIASAFCNCPDKRDVVSPRI
RRRKRS
KAM
P05785 G14.2 precursor J superfamily Conus geographus (Geography cone)
MTSVQSVTCCCLLWLMLSVQPITP
GSPGPAQLSRER
SFRFI
PGGIKEIACHRYCAKGIASAFCICPDKRDVVSPRI
RRRKRS
KAM
P05787 G14.3 precursor J superfamily Conus geographus (Geography cone)
MPSVQSVTRCCLLWLMLSVQLVTP
GSRGTAQLPRDDLDETT
R
EEICRYMCSRKIDYHMCTCPSKRDAISSRIV
RRKRSMAV
P05789 G14.4 precursor J superfamily Conus geographus (Geography cone)
MTSVQSVTCCCLLWLMLSVQPITP
GSPGPAQLSRER
SFKFL
SGGFKEIVCHRYCAKGIAKEFCNCPDKRDVVSSRIR
GRKRS
KAM
P05890 Im14.1 precursor J superfamily Conus imperialis
MPSVRSVTCCCLLWMMFSVQLVTP
GSPGTAQLPRDRTAR
AP
AELILETICPHMCGIGIGEPFCNCRNKRDVVSSRII
RRKRS
MAV
P04537 Lt14.2 precursor J superfamily Conus litteratus
MPSVRSVTCCCLLWLMLSLTLVTP
GSPGPAQLPGHRAAR
VP
AEPILEEICPDMCNSGEGEIFCTCGSRQFVVTLPVIE
RKRS
MAV
P04539 Lt14.3 precursor J superfamily Conus litteratus
MPSVRSVTCCCLLWLMLSLTLVTP
GSPGPAQLPGHRAAR
VP
AEPILEQLCPEMCNRGELEFFCTCGSRQFVVTLPVIE
RKRS
MAV
P04538 Lt14.4 precursor J superfamily Conus litteratus
MPSVRSVTCCCLLWLMLSLTLVTP
GSPGPAQLPGHRAAR
VP
AEQMMEELCPDMCNRGEGEIICTCVLRRHVVSPSIR
GRKKI
DGGVNAYSHF
P05887 Mr14.1 precursor J superfamily Conus marmoreus
MPSVRSVTCCCLLWMMFSVQLVNP
GSPGTAQLSRHRTAR
VP
AEPILEIICPEMCDEGVGEEPFCHCTEKRDAVSSRI
RRRKR
STAV
P05888 Mr14.3 precursor J superfamily Conus marmoreus
MPSVRSVTCCCLLWMMFSVQLVNP
GSPGTAQLFRHRTAR
VL
AELILEIICLEMCEEGVGEEPFCHCTEKRDAVFSRI
RRRKR
STAV
P05889 Mr14.5 precursor J superfamily Conus marmoreus
MPSVRSVTCCCLLWMMFSVQLVNP
GSPGTAQLSRHRTAR
VP
AEPILEIICPEMCDKGVGEEPFCHCTEKRDAVSSRI
RRRKR
STAV
P01184 Pl14.1 precursor J superfamily Conus planorbis
MPSVRSVTCCCLLWMMLSVQLVTPGSP
ATAQLSGQRTAR
GP
GSAICNMACRLGQGHMYPFCNCN
GKRDVVSSSMAV
P01460 Pl14.2 precursor J superfamily Conus planorbis
MPSVRSVTCCCLLWMMFSVQLVTPGSP
ATAQLSGQRTAR
GP
GSAICNMACRLEHGHLYPFCHCR
GKRD
P01185 Pl14.3 precursor J superfamily Conus planorbis
MPSVRSVACCCLLWMMLSVQLVTPGSP
ATAQLSGQRTAR
GP
GSAICNMACRLEHGHLYPFCNCD
GKRDVVSSSMAV
P01183 PlXIVA precursor J superfamily Conus planorbis
MPSVRSVTCCCLLWMMFSVQLVTP
GSPGTAQLSGHRTAR
FP
RPRICNLACRAGIGHKYPFCHCR
GKRDAVSSSMAV
P06371 Vc14.1 precursor J superfamily Conus victoriae
MTSVQSVTCCCFLWLMLSVQLITP
SPPGTAHLPRDGTDR
YI
PDDDESGVCYFLCLMGIDLDECSCPEIQDLGLFTDQ
P06370 Vc14.2 precursor J superfamily Conus victoriae
MTSVQSVTCCCFLWLMLSVQLITP
SPPGTAHLPRDGTDR
NF
PDILGDILCPFFCLSELGLDLGGEFCDCSEIPDLGLLPDQ
P06369 Vc14.3 precursor J superfamily Conus victoriae
MTSVQSVTCCCFLWLMLSVQLISP
SSPGTAHLPRDGTDR
AF
QDIFMVALCPVFCFSNVALESCNCEEILDLVSSLIS
RKRSM
AM
P06368 Vc14.4 precursor J superfamily Conus victoriae
MASVQSVTCCCLLWLMLSVQLVNP
GSPGTAQLSGHRTAR
VP
PEPILEIICPGMCDEGVGKEPFCHCTKKRDAVSSRI
RRRKR
SAAV
P05893 Vi14.1 precursor J superfamily Conus virgo
MPSVRSVTCCCLLWMMFSLTLVTP
GSPGPAQLPGHRAAR
VP
AEQMMEELCPDMCNRGEGEIICTCVLRRHVVFPSIR
GRKRS
MAV
P04535 Vt14.2 precursor J superfamily Conus vitulinus
MPSVRSVTCCCLLWMMLSVQLVT
PGSPGTAQLSGHRTAR
FP
RPRICNLACRAGIGYKYPFCHCR
GKRDAVSSSMAV
P04536 Vt14.7 precursor J superfamily Conus vitulinus
MPSVRSVTCCCLLWMMLSVQLVT
PGSPGTAQLSGHRTAR
FP
RPRICNLACRTGIGYKYPFCHCR
GKRDAVSSSMAV