Protein List

Your search: Gene superfamily in [K superfamily] and Protein Type in [Precursor]

Found 4 entries.


ID Name Gene superfamily Organism Sequence
P05220 Im23.3 precursor K superfamily Conus imperialis
MIMRMTLTLFVLVVMTAASASG
DALTEA
KR
IPYCGQTGAEC
YSWCKEQHLIRCCDFVKYVGMNPPADKC
R
P05221 Im23a precursor K superfamily Conus imperialis
MIMRMTLTLFVLVVMTAASASG
DALTEAKR
IPYCGQTGAEC
YSWCIKQDLSKDWCCDFVKDIRMNPPADKCP
P05222 Im23b precursor K superfamily Conus imperialis
MIMRMTLTLFVLVVMTAASASG
DALTEAKR
IPYCGQTGAEC
YSWCIKQDLSKDWCCDFVKTIARLPPAHICSQ
P05218 Qc23a precursor K superfamily Conus quercinus
MIMRMTLTLFVLVVMTAASASG
DALTEAKR
IPYCGQTGAEC
YSWCIKQDLSKDWCCDFVKTIARLPPAHICSQ