Protein List

Your search: Gene superfamily in [M superfamily] and Protein Type in [Precursor]

Found 476 entries.

ID Name Gene superfamily Organism Sequence
P04216 Ac3.1 precursor M superfamily Conus achatinus
P08379 Am3.1 precursor M superfamily Conus amadis
P08376 Am3.2 precursor M superfamily Conus amadis
P08386 Am3.3 precursor M superfamily Conus amadis
P08392 Am3.4 precursor M superfamily Conus amadis
P00639 Ar3.1 precursor M superfamily Conus arenatus
P00612 ArMMSK-01 precursor M superfamily Conus arenatus
P04777 Bt14-H01 precursor M superfamily Conus betulinus
P04775 Bt14-H01 precursor M superfamily Conus betulinus
P04821 Bt3-3-VP02 precursor M superfamily Conus betulinus
P04909 Bt3-3-VP02 precursor M superfamily Conus betulinus
P04717 Bt3-D02 precursor M superfamily Conus betulinus
P04720 Bt3-D02 precursor M superfamily Conus betulinus
P04722 Bt3-D05 precursor M superfamily Conus betulinus
P04705 Bt3-I02 precursor M superfamily Conus betulinus
P04700 Bt3-I03 precursor M superfamily Conus betulinus
P04702 Bt3-I04 precursor M superfamily Conus betulinus
P04758 Bt3-I05 precursor M superfamily Conus betulinus
P04878 Bt3-IP01 precursor M superfamily Conus betulinus
P04789 Bt3-T01 precursor M superfamily Conus betulinus
P04884 Bt3-TP04 precursor M superfamily Conus betulinus
P04552 Bt3.1 precursor M superfamily Conus betulinus
P04553 Bt3.2 precursor M superfamily Conus betulinus
P04554 Bt3.3 precursor M superfamily Conus betulinus
P04555 Bt3.4 precursor M superfamily Conus betulinus
P04556 Bt3.5 precursor M superfamily Conus betulinus
P04846 Bt3.6 precursor M superfamily Conus betulinus
P05910 Bt9.1 precursor M superfamily Conus betulinus
P04594 Bu15 precursor M superfamily Conus bullatus
P03716 BuIIIA precursor M superfamily Conus bullatus
P03715 BuIIIB precursor M superfamily Conus bullatus
P03714 BuIIIC precursor M superfamily Conus bullatus
P04914 Ca3-IP02 precursor M superfamily Conus caracteristicus
P04837 Ca3-IP05 precursor M superfamily Conus caracteristicus
P04889 Ca3-KP02 precursor M superfamily Conus caracteristicus
P04820 Ca3-KPQR01 precursor M superfamily Conus caracteristicus
P04882 Ca3-TP03 precursor M superfamily Conus caracteristicus
P04842 Ca3-VP01 precursor M superfamily Conus caracteristicus
P04866 Ca3-VV01 precursor M superfamily Conus caracteristicus
P04835 Ca3-WP01 precursor M superfamily Conus caracteristicus
P04712 Ca3-Y01 precursor M superfamily Conus caracteristicus
P04711 Ca3-Y04 precursor M superfamily Conus caracteristicus
P08184 Ca3.1 precursor M superfamily Conus caracteristicus
P08134 Ca3.2 precursor M superfamily Conus caracteristicus
P07697 Ca3.3precursor M superfamily Conus caracteristicus
P04816 Ca4-VRS01 precursor M superfamily Conus caracteristicus
P08132 Ca4.1 precursor M superfamily Conus caracteristicus
P04044 Cal9.3 precursor M superfamily Conus californicus
P06155 CnIIIC precursor M superfamily Conus consors
P05229 CnIIIE precursor M superfamily Conus consors
P05231 CnIIIG precursor M superfamily Conus consors
P04683 Co3-A01 precursor M superfamily Conus coronatus
P04714 Co3-A02 precursor M superfamily Conus coronatus
P04763 Co3-D01 precursor M superfamily Conus coronatus
P04760 Co3-D02 precursor M superfamily Conus coronatus
P04684 Co3-G01 precursor M superfamily Conus coronatus
P04766 Co3-G02 precursor M superfamily Conus coronatus
P04685 Co3-H01 precursor M superfamily Conus coronatus
P04691 Co3-H03 precursor M superfamily Conus coronatus
P04819 Co3-IP02 precursor M superfamily Conus coronatus
P04687 Co3-R02 precursor M superfamily Conus coronatus
P04735 Co3-S01 precursor M superfamily Conus coronatus
P04856 Co3-TP01 precursor M superfamily Conus coronatus
P04841 Co3-VP02 precursor M superfamily Conus coronatus
P05912 Conomarphin-Bt1 precursor M superfamily Conus betulinus
P05913 Conomarphin-Bt2 precursor M superfamily Conus betulinus
P05914 Conomarphin-Bt3 precursor M superfamily Conus betulinus
P04217 Conomarphin-Im1 precursor M superfamily Conus imperialis
P06162 conomarphin-Mr1 precursor M superfamily Conus marmoreus
P06161 conomarphin-Mr1 precursor M superfamily Conus marmoreus
P06001 conomarphin-Mr1 precursor M superfamily Conus marmoreus
P06163 conomarphin-Mr1 precursor M superfamily Conus marmoreus
P02783 conomarphin-Mr1 precursor M superfamily Conus marmoreus
P06164 conomarphin-Mr2 precursor M superfamily Conus marmoreus
P05439 conomarphin-Mr2 precursor M superfamily Conus marmoreus
P06367 conomarphin-Vc1 precursor M superfamily Conus victoriae
P06366 conomarphin-Vc2 precursor M superfamily Conus victoriae
P04861 Cp2-DD02 precursor M superfamily Conus capitaneus
P04823 Cp2-DD02 precursor M superfamily Conus capitaneus
P04692 Cp3-2-R02 precursor M superfamily Conus capitaneus
P04761 Cp3-D02 precursor M superfamily Conus capitaneus
P04681 Cp3-D03 precursor M superfamily Conus capitaneus
P04682 Cp3-D05 precursor M superfamily Conus capitaneus
P04783 Cp3-G01 precursor M superfamily Conus capitaneus
P04690 Cp3-H02 precursor M superfamily Conus capitaneus
P04723 Cp3-I01 precursor M superfamily Conus capitaneus
P04703 Cp3-I02 precursor M superfamily Conus capitaneus
P04689 Cp3-R01 precursor M superfamily Conus capitaneus
P04686 Cp3-R01 precursor M superfamily Conus capitaneus
P04737 Cp3-R01 precursor M superfamily Conus capitaneus
P04713 Cp3-T02 precursor M superfamily Conus capitaneus
P04773 Cp3-V08 precursor M superfamily Conus capitaneus
P04901 Cp3-VP05 precursor M superfamily Conus capitaneus
P04833 Cp3-WP03 precursor M superfamily Conus capitaneus
P05905 Di001 precursor M superfamily Conus distans
P05900 Di6.8 precursor M superfamily Conus distans
P04814 Eb2C01 precursor M superfamily Conus ebraeus
P04793 Eb2C03 precursor M superfamily Conus ebraeus
P05115 Eb2C04 precursor M superfamily Conus ebraeus
P04792 Eb2C07 precursor M superfamily Conus ebraeus
P04813 Eb2C11 precursor M superfamily Conus ebraeus
P04811 Eb2C12 precursor M superfamily Conus ebraeus
P04794 Eb2C12 precursor M superfamily Conus ebraeus
P04812 Eb2C12 precursor M superfamily Conus ebraeus
P04696 Eb3-2-I01 precursor M superfamily Conus ebraeus
P04715 Eb3-2-N01 precursor M superfamily Conus ebraeus
P04730 Eb3-2-N02 precursor M superfamily Conus ebraeus
P04731 Eb3-2-N03 precursor M superfamily Conus ebraeus
P04695 Eb3-2-R03 precursor M superfamily Conus ebraeus
P04694 Eb3-2-R03 precursor M superfamily Conus ebraeus
P04716 Eb3-D04 precursor M superfamily Conus ebraeus
P04734 Eb3-H01 precursor M superfamily Conus ebraeus
P04733 Eb3-H03 precursor M superfamily Conus ebraeus
P04732 Eb3-H03 precursor M superfamily Conus ebraeus
P04836 Eb3-IP01 precursor M superfamily Conus ebraeus
P04838 Eb3-KP02 precursor M superfamily Conus ebraeus
P04879 Eb3-KP02 precursor M superfamily Conus ebraeus
P04822 Eb3-KP04 precursor M superfamily Conus ebraeus
P04848 Eb3-KP04 precursor M superfamily Conus ebraeus
P04911 Eb3-KP04 precursor M superfamily Conus ebraeus
P04736 Eb3-R02 precursor M superfamily Conus ebraeus
P04750 Eb3-T01 precursor M superfamily Conus ebraeus
P04800 Ec2C01 precursor M superfamily Conus emaciatus
P04845 Ec3-GMAR01 precursor M superfamily Conus emaciatus
P04872 Ec3-IP01 precursor M superfamily Conus emaciatus
P04847 Ec3-IP03 precursor M superfamily Conus emaciatus
P04831 Ec3-TP01 precursor M superfamily Conus emaciatus
P05111 Ec3-TP01-2 precursor M superfamily Conus emaciatus
P04908 Ec3-TYN01 precursor M superfamily Conus emaciatus
P04809 Ec3-YDG04 precursor M superfamily Conus emaciatus
P04697 Ec3-YDG04 precursor M superfamily Conus emaciatus
P05909 Eu001 precursor M superfamily Conus eburneus
P04566 Eu3.1 precursor M superfamily Conus eburneus
P04549 Eu3.2 precursor M superfamily Conus eburneus
P04550 Eu3.3 precursor M superfamily Conus eburneus
P04551 Eu3.4 precursor M superfamily Conus eburneus
P04562 Eu3.5 precursor M superfamily Conus eburneus
P03856 Eu5 precursor M superfamily Conus eburneus
P06023 Fla-14 precursor M superfamily Conus flavidus
P06020 Fla-15 precursor M superfamily Conus flavidus
P06021 Fla3.2 precursor M superfamily Conus flavidus
P06022 Fla3.2 precursor M superfamily Conus flavidus
P06024 Fla3.4 precursor M superfamily Conus flavidus
P06025 Fla3.5 precursor M superfamily Conus flavidus
P07896 Fr3.1 precursor M superfamily Conus frigidus
P07775 Ge3.2 precursor M superfamily Conus generalis
P01464 GIIIA precursor M superfamily Conus geographus (Geography cone)
P05726 GIIIB precursor M superfamily Conus geographus (Geography cone)
P04883 Gm3-WP04 precursor M superfamily Conus gloriamaris
P08737 Im3.1 precursor M superfamily Conus imperialis
P08739 Im3.2 precursor M superfamily Conus imperialis
P08741 Im3.3 precursor M superfamily Conus imperialis
P03400 Im6.7 precursor M superfamily Conus imperialis
P08743 Im9.1 precursor M superfamily Conus imperialis
P05911 Im9.13 precursor M superfamily Conus imperialis
P01694 KIIIA precursor M superfamily Conus kinoshitai
P04710 Lp3-Y02 precursor M superfamily Conus leopardus
P01058 Lp3.1 precursor M superfamily Conus leopardus
P01080 Lp3.2 precursor M superfamily Conus leopardus
P01171 Lt0.3 precursor M superfamily Conus litteratus
P01168 Lt0.4 precursor M superfamily Conus litteratus
P01169 Lt0.5 precursor M superfamily Conus litteratus
P03854 Lt10 precursor M superfamily Conus litteratus
P04557 Lt3.6 precursor M superfamily Conus litteratus
P04558 Lt3.7 precursor M superfamily Conus litteratus
P04559 Lt3.8 precursor M superfamily Conus litteratus
P01163 LtIIIA precursor M superfamily Conus litteratus
P01164 LtIIIB precursor M superfamily Conus litteratus
P01165 LtIIIC precursor M superfamily Conus litteratus
P01166 LtIIID precursor M superfamily Conus litteratus
P01167 LtIIIE precursor M superfamily Conus litteratus
P01170 LtXVIA precursor M superfamily Conus litteratus
P04806 Lv3-1-DEG01 precursor M superfamily Conus lividus
P04805 Lv3-1-DEG01 precursor M superfamily Conus lividus
P04784 Lv3-D01 precursor M superfamily Conus lividus
P04782 Lv3-D01 precursor M superfamily Conus lividus
P04781 Lv3-D02 precursor M superfamily Conus lividus
P04864 Lv3-IP01 precursor M superfamily Conus lividus
P04891 Lv3-IP02 precursor M superfamily Conus lividus
P04778 Lv3-V02 precursor M superfamily Conus lividus
P04779 Lv3-V03 precursor M superfamily Conus lividus
P04769 Lv3-V04 precursor M superfamily Conus lividus
P04785 Lv3-V05 precursor M superfamily Conus lividus
P04772 Lv3-V07 precursor M superfamily Conus lividus
P04770 Lv3-V07 precursor M superfamily Conus lividus
P04780 Lv3-Y01 precursor M superfamily Conus lividus
P04699 Lv3-Y02 precursor M superfamily Conus lividus
P04802 Lv3-YH01 precursor M superfamily Conus lividus
P04801 Lv3-YH02 precursor M superfamily Conus lividus
P04804 Lv3-YH04 precursor M superfamily Conus lividus
P04803 Lv3-YH05 precursor M superfamily Conus lividus
P04765 Mi3-D01 precursor M superfamily Conus miles
P04791 Mi3-E03 precursor M superfamily Conus miles
P04790 Mi3-E04 precursor M superfamily Conus miles
P04832 Mi3-IP02 precursor M superfamily Conus miles
P04874 Mi3-QDML01 precursor M superfamily Conus miles
P04749 Mi3-T02 precursor M superfamily Conus miles
P04830 Mi3-TP01 precursor M superfamily Conus miles
P04771 Mi3-V01 precursor M superfamily Conus miles
P04843 Mi3-VYPT01 precursor M superfamily Conus miles
P06170 Mr012 precursors M superfamily Conus marmoreus
P06171 Mr013 precursor M superfamily Conus marmoreus
P06172 Mr014 precursor M superfamily Conus marmoreus
P06176 Mr018 precursor M superfamily Conus marmoreus
P06178 Mr020 precursor M superfamily Conus marmoreus
P05417 Mr034 precursor M superfamily Conus marmoreus
P05419 Mr035 precursor M superfamily Conus marmoreus
P05510 Mr038 precursor M superfamily Conus marmoreus
P06200 Mr061 precursor M superfamily Conus marmoreus
P06201 Mr062 precursor M superfamily Conus marmoreus
P06202 Mr063 precursor M superfamily Conus marmoreus
P06203 Mr064 precursor M superfamily Conus marmoreus
P06204 Mr065 precursor M superfamily Conus marmoreus
P06205 Mr066 precursor M superfamily Conus marmoreus
P06208 Mr069 precursor M superfamily Conus marmoreus
P05430 Mr1.9 precursor M superfamily Conus marmoreus
P05907 Mr106 precursor M superfamily Conus marmoreus
P05906 Mr107 precursor M superfamily Conus marmoreus
P05438 Mr1e precursor M superfamily Conus marmoreus
P03855 Mr2 precursor M superfamily Conus marmoreus
P04852 Mr3-KPAR01 precursor M superfamily Conus marmoreus
P04561 Mr3.10 precursor M superfamily Conus marmoreus
P05415 Mr3.11 precursor M superfamily Conus marmoreus
P05421 Mr3.12 precursor M superfamily Conus marmoreus
P05423 Mr3.13 precursor M superfamily Conus marmoreus
P05425 Mr3.14 precursor M superfamily Conus marmoreus
P06261 Mr3.14 precursor M superfamily Conus marmoreus
P06262 Mr3.14 precursor M superfamily Conus marmoreus
P05427 Mr3.15 precursor M superfamily Conus marmoreus
P05432 Mr3.16 precursor M superfamily Conus marmoreus
P06199 Mr3.16 precursor M superfamily Conus marmoreus
P06207 Mr3.16 precursor M superfamily Conus marmoreus
P06169 Mr3.16 precursor M superfamily Conus marmoreus
P06179 Mr3.16 precursor M superfamily Conus marmoreus
P06210 Mr3.16 precursor M superfamily Conus marmoreus
P06211 Mr3.16 precursor M superfamily Conus marmoreus
P05434 Mr3.17 precursor M superfamily Conus marmoreus
P05436 Mr3.18 precursor M superfamily Conus marmoreus
P01470 Mr3.3 precursor M superfamily Conus marmoreus
P05413 Mr3.3 precursor M superfamily Conus marmoreus
P05412 Mr3.3 precursor M superfamily Conus marmoreus
P01469 Mr3.4 precursor M superfamily Conus marmoreus
P01468 Mr3.5 precursor M superfamily Conus marmoreus
P06198 Mr3.8 precursor M superfamily Conus marmoreus
P06197 Mr3.8 precursor M superfamily Conus marmoreus
P06214 Mr3.8 precursor M superfamily Conus marmoreus
P06215 Mr3.8 precursor M superfamily Conus marmoreus
P06195 Mr3.8 precursor M superfamily Conus marmoreus
P06216 Mr3.8 precursor M superfamily Conus marmoreus
P06194 Mr3.8 precursor M superfamily Conus marmoreus
P06213 Mr3.8 precursor M superfamily Conus marmoreus
P06218 Mr3.8 precursor M superfamily Conus marmoreus
P06219 Mr3.8 precursor M superfamily Conus marmoreus
P06220 Mr3.8 precursor M superfamily Conus marmoreus
P06221 Mr3.8 precursor M superfamily Conus marmoreus MFLFKIWV
P01082 Mr3.8 precursor M superfamily Conus marmoreus
P06168 Mr3.8 precursor M superfamily Conus marmoreus
P06212 Mr3.8 precursor M superfamily Conus marmoreus
P04560 Mr3.9 precursor M superfamily Conus marmoreus
P03857 Mr6 precursor M superfamily Conus marmoreus
P06225 MrIIIB precursor M superfamily Conus marmoreus
P05414 MrIIIB precursor M superfamily Conus marmoreus
P01471 MrIIID precursor M superfamily Conus marmoreus
P06226 MrIIID precursor M superfamily Conus marmoreus
P06223 MrIIID precursor M superfamily Conus marmoreus
P06177 MrIIID precursor M superfamily Conus marmoreus
P06222 MrIIID precursor M superfamily Conus marmoreus
P06196 MrIIIE precursor M superfamily Conus marmoreus
P06209 MrIIIE precursor M superfamily Conus marmoreus
P06175 MrIIIE precursor M superfamily Conus marmoreus
P05429 MrIIIE precursor M superfamily Conus marmoreus
P01081 MrIIIE precursor M superfamily Conus marmoreus
P06206 MrIIIF precursor M superfamily Conus marmoreus
P04527 MrIIIF precursor M superfamily Conus marmoreus
P06173 MrIIIF precursor M superfamily Conus marmoreus
P01466 MrIIIG precursor M superfamily Conus marmoreus
P06224 MrIIIG precursor M superfamily Conus marmoreus
P04226 P3.9 precursor M superfamily Conus purpurascens
P01407 PIIIA precursor M superfamily Conus purpurascens
P01406 PIIIE precursor M superfamily Conus purpurascens
P00630 Pn3.1 precursor M superfamily Conus pennaceus
P00637 Pn3.2 precursor M superfamily Conus pennaceus
P00771 PnIVB precursor M superfamily Conus pennaceus QPADQPAERMQDDISSEHHPFFDPVKR
P00618 PnIVB precursor M superfamily Conus pennaceus
P02831 PrIIIE precursor M superfamily Conus parius
P05553 Pu3.1 precursor M superfamily Conus pulicarius
P05555 Pu3.2 precursor M superfamily Conus pulicarius
P05556 Pu3.3 precursor M superfamily Conus pulicarius
P04204 Pu3.4 precursor M superfamily Conus pulicarius
P04206 Pu3.5 precursor M superfamily Conus pulicarius
P04208 Pu3.6 precursor M superfamily Conus pulicarius
P04854 Qc3-IP01 precursor M superfamily Conus quercinus
P04858 Qc3-IP02 precursor M superfamily Conus quercinus
P04862 Qc3-IP03 precursor M superfamily Conus quercinus
P04807 Qc3-TDG01 precursor M superfamily Conus quercinus
P04808 Qc3-YDG01 precursor M superfamily Conus quercinus
P04818 Qc3.1 precursor M superfamily Conus quercinus
P04810 Qc3.1 precursor M superfamily Conus quercinus
P01083 Qc3.1 precursor M superfamily Conus quercinus
P07820 Qc3.2 precursor M superfamily Conus quercinus
P07822 Qc3.3 precursor M superfamily Conus quercinus
P07823 Qc3.5 precursor M superfamily Conus quercinus
P07824 Qc3.6 precursor M superfamily Conus quercinus
P08272 Qc3.7 precursor M superfamily Conus quercinus
P07825 Qc3.8 precursor M superfamily Conus quercinus
P07826 Qc32.1 precursor M superfamily Conus quercinus
P08555 reg3.10 precursor M superfamily Conus regius
P08563 reg3.14 precursor M superfamily Conus regius
P08565 reg3.15 precursor M superfamily Conus regius
P08569 reg3.17 precursor M superfamily Conus regius
P08545 reg3.5 precursor M superfamily Conus regius
P08547 reg3.6 precursor M superfamily Conus regius
P08549 reg3.7 precursor M superfamily Conus regius
P08551 reg3.8 precursor M superfamily Conus regius
P08571 reg3a precursor M superfamily Conus regius MMSKLRVLLTICLLLFPLSALPLDGDQPADQPAKRMWNGKL
P08537 reg3f precursor M superfamily Conus regius
P08535 reg3k precursor M superfamily Conus regius
P01521 RIIIK precursor M superfamily Conus radiatus
P04725 Rt3-E01 precursor M superfamily Conus rattus
P04727 Rt3-E05 precursor M superfamily Conus rattus
P04873 Rt3-IP03 precursor M superfamily Conus rattus
P04886 Rt3-KP01 precursor M superfamily Conus rattus
P04870 Rt3-KP01 precursor M superfamily Conus rattus
P04853 Rt3-KP06 precursor M superfamily Conus rattus
P04829 Rt3-TP02 precursor M superfamily Conus rattus
P04881 Rt3-TP04 precursor M superfamily Conus rattus
P04844 Rt3-WP01 precursor M superfamily Conus rattus
P04776 S14-H01 precursor M superfamily Conus striatus (Striated cone)
P04719 S3-D01 precursor M superfamily Conus striatus (Striated cone)
P04787 S3-E02 precursor M superfamily Conus striatus (Striated cone)
P04756 S3-E02 precursor M superfamily Conus striatus (Striated cone)
P04788 S3-E03 precursor M superfamily Conus striatus (Striated cone)
P04893 S3-G04 precursor M superfamily Conus striatus (Striated cone)
P04724 S3-I01 precursor M superfamily Conus striatus (Striated cone)
P04757 S3-I01 precursor M superfamily Conus striatus (Striated cone)
P04706 S3-I05 precursor M superfamily Conus striatus (Striated cone)
P04895 S3-KP02 precursor M superfamily Conus striatus (Striated cone)
P04887 S3-KP02 precursor M superfamily Conus striatus (Striated cone)
P04890 S3-KP02 precursor M superfamily Conus striatus (Striated cone)
P04748 S3-L02 precursor M superfamily Conus striatus (Striated cone)
P04774 S3-S01 precursor M superfamily Conus striatus (Striated cone)
P04795 S3-S02 precursor M superfamily Conus striatus (Striated cone)
P04867 S3-TS01 precursor M superfamily Conus striatus (Striated cone)
P04904 S3-VP01 precursor M superfamily Conus striatus (Striated cone)
P04871 S3-WP01 precursor M superfamily Conus striatus (Striated cone)
P04698 S3-Y01 precursor M superfamily Conus striatus (Striated cone)
P00825 SIIIA precursor M superfamily Conus striatus (Striated cone)
P04905 SIIIA precursor M superfamily Conus striatus (Striated cone)
P01629 SmIIIA precursor M superfamily Conus stercusmuscarum PLFDKR
P05227 T3.1 precursor M superfamily Conus tulipa (tulip cone)
P04755 Tr3-E02 precursor M superfamily Conus terebra
P04851 Ts3-IP07 precursor M superfamily Conus tessulatus
P04906 Ts3-IP07 precursor M superfamily Conus tessulatus
P04824 Ts3-IP07 precursor M superfamily Conus tessulatus
P04868 Ts3-IP10 precursor M superfamily Conus tessulatus
P04875 Ts3-SGN01 precursor M superfamily Conus tessulatus
P04709 Ts3-Y01 precursor M superfamily Conus tessulatus
P04899 Ts3.1 precursor M superfamily Conus tessulatus
P00621 Ts3.1 precursor M superfamily Conus tessulatus
P00623 Ts3.2 precursor M superfamily Conus tessulatus
P00626 Ts3.2 precursor M superfamily Conus tessulatus
P00628 Ts3.3 precursor M superfamily Conus tessulatus
P00625 Ts3.3 precursor M superfamily Conus tessulatus
P00627 Ts3.4 precursor M superfamily Conus tessulatus
P00632 Ts3.5 precursor M superfamily Conus tessulatus
P04815 Ts3.6 precursor M superfamily Conus tessulatus
P00633 Ts3.6 precursor M superfamily Conus tessulatus
P00638 Ts3.7 precursor M superfamily Conus tessulatus
P07526 TsIIIA precursor M superfamily Conus tessulatus
P00611 TsMMSK-021 precursor M superfamily Conus tessulatus
P00610 TsMMSK-021 precursor M superfamily Conus tessulatus
P04786 Tx3-E05 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04754 Tx3-E09 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04729 Tx3-E09 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04728 Tx3-E09 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04903 Tx3-KP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
P06139 Tx3-KP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04892 Tx3-KP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04855 Tx3-KP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04885 Tx3-KP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04877 Tx3-KP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04839 Tx3-KP03 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04743 Tx3-L02 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04744 Tx3-L03 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04910 Tx3-SR01 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04834 Tx3-TP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04897 Tx3-TP08 precursor M superfamily Conus textile (Cloth-of-gold cone) M
P04888 Tx3-TP11 precursor M superfamily Conus textile (Cloth-of-gold cone) M
P04850 Tx3-WP04 precursor M superfamily Conus textile (Cloth-of-gold cone)
P01467 Tx3f precursor M superfamily Conus textile (Cloth-of-gold cone)
P00629 Tx3h precursor M superfamily Conus textile (Cloth-of-gold cone)
P01472 Tx3h precursor M superfamily Conus textile (Cloth-of-gold cone)
P00640 TxIIIA precursor M superfamily Conus textile (Cloth-of-gold cone)
P01401 TxIIIB precursor M superfamily Conus textile (Cloth-of-gold cone)
P01396 TxIIIC precursor M superfamily Conus textile (Cloth-of-gold cone)
P04860 TxIIIC precursor M superfamily Conus textile (Cloth-of-gold cone)
P04742 TxMLKM-021 precursor M superfamily Conus textile (Cloth-of-gold cone)
P00631 TxMLKM-021 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04741 TxMLKM-021 precursor M superfamily Conus textile (Cloth-of-gold cone)
P00620 TxMMSK-01 precursor M superfamily Conus textile (Cloth-of-gold cone)
P00614 TxMMSK-02 precursor M superfamily Conus textile (Cloth-of-gold cone)
P04896 TxMMSK-02 precursor M superfamily Conus textile (Cloth-of-gold cone)
P00613 TxMMSK-03 precursor M superfamily Conus textile (Cloth-of-gold cone)
P00615 TxMMSK-04 precursor M superfamily Conus textile (Cloth-of-gold cone)
P00617 TxMMSK-05 precursor M superfamily Conus textile (Cloth-of-gold cone)
P00616 TxMMSK-06 precursor M superfamily Conus textile (Cloth-of-gold cone)
P06365 Vc3 precursor M superfamily Conus victoriae
P06364 Vc3.1 precursor M superfamily Conus victoriae
P06355 Vc3.10 precursor M superfamily Conus victoriae
P06363 Vc3.2 precursor M superfamily Conus victoriae
P06362 Vc3.3 precursor M superfamily Conus victoriae
P06361 Vc3.4 precursor M superfamily Conus victoriae
P06360 Vc3.5 precursor M superfamily Conus victoriae
P06359 Vc3.6 precursor M superfamily Conus victoriae
P06358 Vc3.7 precursor M superfamily Conus victoriae
P06357 Vc3.8 precursor M superfamily Conus victoriae
P06356 Vc3.9 precursor M superfamily Conus victoriae
P05908 Vi001 precursor M superfamily Conus virgo
P00619 Vn3.1 precursor M superfamily Conus ventricosus
P00622 Vn3.2 precursor M superfamily Conus ventricosus
P00624 Vn3.3 precursor M superfamily Conus ventricosus
P00634 Vn3.4 precursor M superfamily Conus ventricosus
P00635 Vn3.5 precursor M superfamily Conus ventricosus
P00636 Vn3.6 precursor M superfamily Conus ventricosus
P04863 Vr3-3-VP01 precursor M superfamily Conus varius
P05113 Vr3-D01 precursor M superfamily Conus varius
P04857 Vr3-IP01 precursor M superfamily Conus varius
P04825 Vr3-IP03 precursor M superfamily Conus varius
P04859 Vr3-IP08 precursor M superfamily Conus varius
P04745 Vr3-L01 precursor M superfamily Conus varius
P04796 Vr3-NPP01 precursor M superfamily Conus varius
P04740 Vr3-Q01 precursor M superfamily Conus varius
P04797 Vr3-SP01 precursor M superfamily Conus varius
P04798 Vr3-SP01 precursor M superfamily Conus varius
P04799 Vr3-SP02 precursor M superfamily Conus varius
P04827 Vr3-SP04 precursor M superfamily Conus varius
P04751 Vr3-T05 precursor M superfamily Conus varius
P04865 Vr3-TYN01 precursor M superfamily Conus varius
P04900 Vr3-VP08 precursor M superfamily Conus varius
P04840 Vr3-VP08 precursor M superfamily Conus varius
P04869 Vr3-WP04 precursor M superfamily Conus varius
P04907 Vr3-WP04 precursor M superfamily Conus varius
P04707 Vr3-Y02 precursor M superfamily Conus varius
P04718 VrD01 precursor M superfamily Conus varius
P04721 Vt3-D02 precursor M superfamily Conus vitulinus
P04726 Vt3-E03 precursor M superfamily Conus vitulinus
P04894 Vt3-EP01 precursor M superfamily Conus vitulinus
P04826 Vt3-KP04 precursor M superfamily Conus vitulinus
P04902 Vt3-KP04 precursor M superfamily Conus vitulinus
P04746 Vt3-L01 precursor M superfamily Conus vitulinus
P04898 Vt3-SP01 precursor M superfamily Conus vitulinus
P04912 Vt3-SR01 precursor M superfamily Conus vitulinus
P04752 Vt3-T01 precursor M superfamily Conus vitulinus
P04828 Vt3-TP01 precursor M superfamily Conus vitulinus
P04849 Vt3-TP09 precursor M superfamily Conus vitulinus M
P04708 Vt3-Y01 precursor M superfamily Conus vitulinus
P04219 Vt3.1 precursor M superfamily Conus vitulinus
P04060 Vt3.2 precursor M superfamily Conus vitulinus
P04565 Vt3.3 precursor M superfamily Conus vitulinus
P04693 Vx3-2-R01 precursor M superfamily Conus vexillum
P04753 Vx3-A01 precursor M superfamily Conus vexillum
P04764 Vx3-D03 precursor M superfamily Conus vexillum
P04762 Vx3-D03 precursor M superfamily Conus vexillum
P04759 Vx3-D03 precursor M superfamily Conus vexillum
P04768 Vx3-F01 precursor M superfamily Conus vexillum
P04767 Vx3-G02 precursor M superfamily Conus vexillum
P04880 Vx3-HYQ01 precursor M superfamily Conus vexillum
P04701 Vx3-I03 precursor M superfamily Conus vexillum
P04704 Vx3-I04 precursor M superfamily Conus vexillum
P04747 Vx3-L03 precursor M superfamily Conus vexillum
P04739 Vx3-Q01 precursor M superfamily Conus vexillum
P04688 Vx3-R01 precursor M superfamily Conus vexillum
P04913 Vx3-VV01 precursor M superfamily Conus vexillum
P04876 Vx3-VV01 precursor M superfamily Conus vexillum
P04738 Vx3-Y01 precursor M superfamily Conus vexillum
P00823 VxII precursor M superfamily Conus vexillum