Protein List

Your search: Gene superfamily in [M superfamily] and Protein Type in [Precursor]

Found 443 entries.


ID Name Gene superfamily Organism Sequence
P04216 Ac3.1 precursor M superfamily Conus achatinus
LGVLVTIFLVLFPMATL
QLDGDQTADRHAGERDQDPLEQYR
NLKHVL
RR
TRNYYLYPARPENSWWT
P00639 Ar3.1 precursor M superfamily Conus arenatus
MLKMEVVLFTFLVLFPLSTLQ
LETDQPVERYVENKQDLNPD
ESRNFMLPIVKK
CCTACRMPPCKCCA
P00612 ArMMSK-01 precursor M superfamily Conus arenatus
MMSKLGVLLTICMLLFPLTA
LPLDGDQPADRPAERMQDDFI
SEQHPLFNPIKR
CCDWPCTIGCVPCC
K
P04775 Bt14-H01 precursor M superfamily Conus betulinus
MLKMGVVLFTFLVLFPLAT
LQLDADQPVERHAENKQDLIPD
ERRGILLHALKQR
VWCDWEWCYGDCHCFD
P04777 Bt14-H01 precursor M superfamily Conus betulinus
MFKMGVVLFTFLVLFPLAT
LQLDADQPVERHAENKQDLIPD
ERRGILLHALKQR
VWCDWEWCYGDCHCFD
P04909 Bt3-3-VP02 precursor M superfamily Conus betulinus
MMSKLGVLLTICMLLFPLAA
FPLDGDQPADQPAERMQYDML
RAMNPWFDPIKR
CRCEQTCGTCVPCC
P04821 Bt3-3-VP02 precursor M superfamily Conus betulinus
MMSKLGVLLTICMLLFPLAA
FPLDGDQPADQPAERMQYDRL
RAMNPWFDPIKR
CRCEQTCGTCVPCC
P04717 Bt3-D02 precursor M superfamily Conus betulinus
MLKLGMVLFIFLVLLPLATLRLDA
DQPVERNVNKQGLKPDE
RRRFRFSAPRKR
ECCELEWCDGACDCCD
P04720 Bt3-D02 precursor M superfamily Conus betulinus
MLKLGMVLFIFLVLFPLATLHLDA
DQPVERNVNKQGLKPNE
RRRFRFSAPRKR
ECCELEWCDGACDCCD
P04722 Bt3-D05 precursor M superfamily Conus betulinus
MLKLGMVLFIFLVLFPLATLHLDA
DQPVERNVNKQGLKPDE
RRRFGFSAPRKR
ECCEWEWCDGACDCCN
P04705 Bt3-I02 precursor M superfamily Conus betulinus
MFKMGVVLFTYLVLFPLATFQ
LDADQPAERYAENKQDLNPD
ERMKFKLHNLGQR
RCCISPACHDECICCID
R
P04700 Bt3-I03 precursor M superfamily Conus betulinus
MFKMGVVLFTYLVLFPLATFQLDA
DQPVERYVENIQDLNPD
ERMEFILHALGQR
RCCVHPACHDDCICCIT
R
P04702 Bt3-I04 precursor M superfamily Conus betulinus
MFKMGVVLFTYLVLFPLATFQLDA
DQPVERYVENIQDLNPD
ERMEFILHALGQR
RCCVHPACHDDCICCID
R
P04758 Bt3-I05 precursor M superfamily Conus betulinus
MLKLGMVLFIFLVLLPLATLHLDA
DQPVERNVNKQGLKPDE
RRRFILHALGQR
QCCDWPWCDDCICCD
P04878 Bt3-IP01 precursor M superfamily Conus betulinus
MMSKLGVLLTVCLLLFPLTA
VPMDGDQPADLPALRMQDFAP
EHSPWFDPVRR
CCSQDCRVCIPCCPH
P04789 Bt3-T01 precursor M superfamily Conus betulinus
MGVVLFTFLVLFPLATLQLDA
DQPVERYAENKQDHYPGESR
GILKSALR
KCCTMSVCQPPPVCTCCA
P04884 Bt3-TP04 precursor M superfamily Conus betulinus
MMSKLGVLLTICMLLIPLTAVLL
DRDQPADRHAERMKYMLR
AMSPWFDPVKR
CCKVLCESCTPCC
P04552 Bt3.1 precursor M superfamily Conus betulinus
MMSKLGVLLTICLLLFPLT
ALPMDGDQPADQPAERLQDISP
KEIPGSDPFKR
CCHAPYCTPPHLGCPCC
GK
P04553 Bt3.2 precursor M superfamily Conus betulinus
MMSKLGVLLTICLLLFPLT
ALPMDGDQPVDRPAERMQGNIS
SEQHPMFDPIKR
CCTQSCTTCFPCC
P04554 Bt3.3 precursor M superfamily Conus betulinus
MMSKLGVLLTICLLLFPLT
ALPMDGDQPQERKEDGKSAALQ
PWFDPVKR
CCQAACSPWLCLPCC
R
P04555 Bt3.4 precursor M superfamily Conus betulinus
MMSKLGVLLTICLLLFPLT
ALPMDGDQPQERKEDEKSAALQ
PWFDPVKR
CCQAGCSRYMCLPCCQ
P04556 Bt3.5 precursor M superfamily Conus betulinus
MMSKLGVLLTICLLLFPLT
ALPMDGDQTADKPAQRKLVISP
TRR
YWTRSACCYIEEGEKCPASCKLCC
P04846 Bt3.6 precursor M superfamily Conus betulinus
MMFKLGVLLTIYMLLFPFTALP
LDGDQPADQPLERMQYDML
RAVNPWFDPVKR
CCSRNCAVCIPCCPNWPA
P05910 Bt9.1 precursor M superfamily Conus betulinus
MLKVGVVLLIFLVLMSSA
IPQDRDFSGQQSDKKQIRQRDIF
GSKMRRYSPNIQKR
CIVGTPCHVCRSQSKSCNGWLGKQGYC
GYC
G
P04594 Bu15 precursor M superfamily Conus bullatus
MLKMGVLLFTFLVLFPLATLQLDA
DQPVERYADNKQDLNPD
ER
MIFLFGGCCRMSSCQPPPVCNCCAKQDLNPDER
P03716 BuIIIA precursor M superfamily Conus bullatus
MMSKLGVLLTICLLLFPLFA
LPQDGDQPADRPAERMQDDIS
SEQNSLLEKRVTDR
CCKGKRECGRWCRDHSRCC
GRR
P03715 BuIIIB precursor M superfamily Conus bullatus
MMSKLGVLLTICLLLFPLFA
LPQDGDQPADRPAERMQDDIS
SEQNPLLEKRVGER
CCKNGKRGCGRWCRDHSRCC
GRR
P03714 BuIIIC precursor M superfamily Conus bullatus
MMSKLGVLLTICLLLFPLFA
LPQDGDQPADRPAERMQDDLS
SEQHPLFEKRIVDR
CCNKGNGKRGCSRWCRDHSRCC
GRR
P04914 Ca3-IP02 precursor M superfamily Conus caracteristicus
MMSKLGVLLTICLLLFPITG
LPLDEDQHADLPALRAQAFEP
EHSPWFDPVRR
CCSQDCSVCIPCCPN
P04837 Ca3-IP05 precursor M superfamily Conus caracteristicus
MMSKLGVLLTICLLLFPLT
AVPLDGDQPADRPAERKQDVSS
EQHPFFDPVKR
CCRRGYMGCIPCCF
P04889 Ca3-KP02 precursor M superfamily Conus caracteristicus
MMSKLGALLTICLLLFSLTA
VPLDGDQHADQPAERLQDDIS
SENNPMFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
P04820 Ca3-KPQR01 precursor M superfamily Conus caracteristicus
MMSKLGVLLTICLLLFPLT
ALPMDGDEPANRPVERMQDNIS
SEQYPLFEKR
RDCCTPPKKCKDRQCKPQRCCA
GR
P04882 Ca3-TP03 precursor M superfamily Conus caracteristicus
MMSKLGVLLITCLLLFPLTA
VPLDGDQHADRPAERLQDDIS
SENHPFFDPVKR
CCNAGFCRFGCTPCCY
P04842 Ca3-VP01 precursor M superfamily Conus caracteristicus
MMSKLGVLLTICLLLFPITA
DPLVEDQPADLPAERMQDIAT
EQHPLFDPVKR
CCDRPCSIGCVPCCLP
P04866 Ca3-VV01 precursor M superfamily Conus caracteristicus
MMSKLGVLLTICLVLFPLTA
LPLDGDQPANRPAERAQDDTS
AAQNPWFDHVKR
CCTVCTTGCVVCC
P04835 Ca3-WP01 precursor M superfamily Conus caracteristicus
MSKLGALLTICLLLFSLTA
VPLDGDQHADQPAQRLQDRLPT
EDHPLYDPVKR
CCDDSECDYSCWPCCIFS
P04712 Ca3-Y01 precursor M superfamily Conus caracteristicus
MLKMGVVLFTFLVLFPLATFQLDA
DQPVERYAENKQDLSPD
KRVEFILHALGQR
FCCVFPWCTGCYCC
R
P04711 Ca3-Y04 precursor M superfamily Conus caracteristicus
MLKMGVVLFTFLVLFPLAT
LQLDADQPVERYAENKQDLSPD
KRVEFILHALGQR
GCCIVPWCTGCYCCH
P04816 Ca4-VRS01 precursor M superfamily Conus caracteristicus
MGVVLFTFLVLFPLATLQLDA
DQPVERYTENKQDLSPDDRM
GFILPALRR
YECCVWPYCDGGCSSCVRSCE
P04044 Cl9.1 precursor M superfamily Conus californicus
MMGKLGVVLFICLVLFPLETL
QLEGGQQADRHVDQLEGNPN
RETRTIEVR
CTTMNCLKGHCGCSPDCGSC
P06155 CnIIIC precursor M superfamily Conus consors
MSKLGVLLTICLLLFPLFA
LPLDGDQPADRPAERMQDDISS
EKHPLFDKR
QGCCNGPKGCSSKWCRDHARCC
GRR
P05229 CnIIIE precursor M superfamily Conus consors
MSKLGVLLTICLLLFPLTA
LPMDGDQSVDRPAERMQDDISS
EQYPLFNQKR
RCCGEGASCPVYSRDRLICSCC
P05231 CnIIIG precursor M superfamily Conus consors
MSKLGVLLTICLLLLPLTA
LPMDEDQPADQPADRMQDDISS
EQYPLFDKR
QKCCGKGMTCPRYFRDNFICGCC
P04683 Co3-A01 precursor M superfamily Conus coronatus
MLKMGMVLFVFLVLFPLATFQLDA
DQPVERYVGNKQDLNPD
ERRGFISPALRQK
RCCSESHCNAGCACCD
P04714 Co3-A02 precursor M superfamily Conus coronatus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYVENKQDLNP
DERRGSILPAQKQQR
CCEEPFCNAGCACCNP
P04763 Co3-D01 precursor M superfamily Conus coronatus
MLKMGVVLFVFLVLFPLAT
LQLDADQPVERYAENKQDLNAD
ER
MGYILPALSQQTCCVRPWCDGACDCCVDS
P04760 Co3-D02 precursor M superfamily Conus coronatus
MLKMGVVLFVFLVLFPMATLQLDA
DQPVERYAENKQDHNAD
ER
MGYILPALSQQTCCVRPWCDGACDCCVDP
P04684 Co3-G01 precursor M superfamily Conus coronatus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYVENKQDLNP
DERRGFILPALKQK
RCCPASACNGACGCCE
P04766 Co3-G02 precursor M superfamily Conus coronatus
MLKMGVVLFVFLVLFPLATFQLDA
DQPVKRYAKYKQDLNTD
KRMRLILPALRQR
QCCGWEWCDDICGCCE
P04685 Co3-H01 precursor M superfamily Conus coronatus
MMLKMVVVLFVFLVLFPLATL
QLDADQPVERYVGNKQDLNP
DERRGFISLALSRR
RCCTFSECDGNCHCCQ
G
P04691 Co3-H03 precursor M superfamily Conus coronatus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYVGNKQDLNP
DERRGFISPALRRR
RCCNWQECDGNCHCCQ
R
P04819 Co3-IP02 precursor M superfamily Conus coronatus
MMSKLGVLLTICLLLFPITG
LPLDEDQHDDLPALRAQDFEP
EHSPWFDPVRR
CCSQDCSVCIPCCPN
P04687 Co3-R02 precursor M superfamily Conus coronatus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVKRYVGNKQDLYP
DERRGFISPALRRR
RCCTWQECDGNCRCCQ
R
P04735 Co3-S01 precursor M superfamily Conus coronatus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYVENKQDLNL
DERTGYILHVLGQR
TCCPPGICSSDKCSCC
G
P04856 Co3-TP01 precursor M superfamily Conus coronatus
MMFKLGVFLTICLLPFSLNA
VPLDGDQPADQPAERLLDDIS
FENNPFYDPAKR
CCRTCFGCTPCC
G
P04841 Co3-VP02 precursor M superfamily Conus coronatus
MMSKLGVLLTICLLLFPITA
DPLVEDQPADRPADRMQDIAT
EQHPLFDPVKR
CCDRPCGIGCVPCCLP
P05912 Conomarphin-Bt1 precursor M superfamily Conus betulinus
MSKLGVVLCIFLILFPMATL
QLDGDQTADRHADERDQDLAG
QYRNLKRVLKR
GWVYHANPEANSWWT
LV
P05913 Conomarphin-Bt2 precursor M superfamily Conus betulinus
MSKLGVVLCIFLILFPMATL
QLDGDQTADRHADERDQDLAG
QYPNLKRVLKR
GWVYHAHPEPNSFWT
LV
P05914 Conomarphin-Bt3 precursor M superfamily Conus betulinus
MLKVGVVLCIFLILFPMATL
QLDGDQTADRHADERDQDLAE
QYRNLKRVLKR
GWVYHAHPDANSWWS
LV
P04217 Conomarphin-Im1 precursor M superfamily Conus imperialis
MMSKLGVLLCIFLVLFPMATL
QLDGDQTADRHADQRGQDLT
EQQRNSKRVL
KKR
DWEYHAHPKPNSFWT
LV
P02783 conomarphin-Mr1 precursor M superfamily Conus marmoreus
MMSKLGVLLCIFLVLFPMATL
QLDGDQTADRHADQRGQDLT
EQQRNSKRVLKKR
DWEYHAHPKPNSFWT
LV
P06162 conomarphin-Mr1 precursor M superfamily Conus marmoreus
MSKLGVVLCIFLVLFPMATL
QLDGDQTADRHADQRGQDLTE
QHRNLKRVLKKR
DWEYHAHPKPNSFWT
LV
P06163 conomarphin-Mr1 precursor M superfamily Conus marmoreus
MSKLGVVLCIFLVLFPMATL
QLDGDQTADRHADQRGQDLTE
QQRNSKRVLKKR
DWEYHAHPKPNSFWT
LVERHQAGYSRTVV
V
P06001 conomarphin-Mr1 precursor M superfamily Conus marmoreus
MSKLGVVLCIFLVLFPMATL
QLDGDQTADRHADQRGQDLTE
QQRNSKRVLKKR
DWEYHAHPKPNSFWT
LV
P06161 conomarphin-Mr1 precursor M superfamily Conus marmoreus
MSKLGVVLCIFLVLFPMATL
QLDGDQTADHHADQRGQDLTE
QQRNSKRVLKKR
DWEYHAHPKPNSFWT
LV
P05439 conomarphin-Mr2 precursor M superfamily Conus marmoreus
MSKLGVVLCIFLVLFPMATL
QLDGDQTADRHADQRGQDLTE
QHRNLKRVLKKR
DWVNHAHPQPNSIWS
LV
P06164 conomarphin-Mr2 precursor M superfamily Conus marmoreus
MSKLGVVLCIFLVLFPMATL
QLDGDQTADRHADQRGQDLTE
QHQNLKRVLKKR
DWVNHAHPQPNSIWS
LV
P06367 conomarphin-Vc1 precursor M superfamily Conus victoriae
MSKLGVVLCIFLVLFPMATL
QLDGDQTADRPADERGQDLAE
QYRNLKRVMER
SSEHRAHHTHPNDNSFWTLV
P06366 conomarphin-Vc2 precursor M superfamily Conus victoriae
MSKLGVVLCIFLVLFPMATL
QLDGDQTADRPADERGQDLAE
QYRNLKRVMER
GWHYHPYQNPKPT
GRMFARHRAGYSRTVVV
P04861 Cp2-DD02 precursor M superfamily Conus capitaneus
MMSKLGVLVTICLLLFPLTA
FPLDGDQPADHPAKRTQDR
NS
ASLISSWVDNTNFCCCSHDCATICDDCF
P04823 Cp2-DD02 precursor M superfamily Conus capitaneus
MMSKLGVLVTICLLLFPLTAF
GDQPADHPAKRTQDR
NSASL
ISSWVDNTNFCCCSHDCATICDDCF
P04692 Cp3-2-R02 precursor M superfamily Conus capitaneus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERDAENKQDNPD
ERKGFVSLALR
RPCCSLRWCSNYCRCGI
P04761 Cp3-D02 precursor M superfamily Conus capitaneus
MLKMGVVLFVFLVLFPMATLQLDA
DQPVERYAENKQDHNAD
ERMGLILPALRQR
TCCVRPWCDGACDCCVDP
P04681 Cp3-D03 precursor M superfamily Conus capitaneus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYAENKQDLHP
NERTGFILPAMRRQ
GCCIEPLCYQYDCDCCRYL
P04682 Cp3-D05 precursor M superfamily Conus capitaneus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYAENKQDLNP
DGKREFILPAMRRQ
GCCIEPLCYQYDCDCCRHL
P04783 Cp3-G01 precursor M superfamily Conus capitaneus
MLKMGVVLFVFLVLFPLATFQLDA
DQPVKRYAKYKQDLNAD
KRMRLILPALRQR
QCCGWEWCDDICGCCE
P04690 Cp3-H02 precursor M superfamily Conus capitaneus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYVGNKQDLNP
DERRGFISPALRRR
RCCTWQECDGNCHCCQ
R
P04723 Cp3-I01 precursor M superfamily Conus capitaneus
MLKMGVMLFTFLVLFPLATLQLDA
DQPVERYAEDKQDLNRD
ERMGFILHALGQR
QCCDWPWCDDCICCD
P04703 Cp3-I02 precursor M superfamily Conus capitaneus
MFKMGVVLFTYLVLFPLATFQLDA
DQPVERYAENKQDLNPD
ERMKFKLHNLGQR
RCCISPACHDECICCID
R
P04686 Cp3-R01 precursor M superfamily Conus capitaneus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVKRYVGNKQDLNP
DERRGFISPALRRR
RCCTWQECDGNCRCCQ
R
P04689 Cp3-R01 precursor M superfamily Conus capitaneus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYVGNKQDLNP
DERRGFISPALRRR
RCCTWQECDGNCRCCQ
R
P04737 Cp3-R01 precursor M superfamily Conus capitaneus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYAENKQDLNP
DGKR
EFILPAVGRTCCDLTWCDGNCRCCTP
R
P04713 Cp3-T02 precursor M superfamily Conus capitaneus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYVENKQDLNP
DERRGSILPAQKQQR
CCEAPFCNAGCTCCNP
P04773 Cp3-V08 precursor M superfamily Conus capitaneus
MLKMGVVLFTFLVLFPLAT
LQLDADQPRARYAENKQDFNRN
ERTKMILSALGQR
RCCIWPECGSCVCCL
P04901 Cp3-VP05 precursor M superfamily Conus capitaneus
MMSKLGVLLTICLLLFPITA
DPLVEDQPADRPADRMQDIAT
EQHPLFDPVKR
CCDRPCSIGCVPCCLP
P04833 Cp3-WP03 precursor M superfamily Conus capitaneus
MMSKLGALLTICLLLFSLTA
VPLDGDQHADQPAQRLQDRIP
TEDHPLFDPNKR
CCDDSECSYSCWPCCY
G
P05905 Di001 precursor M superfamily Conus distans
MLKMGVVLFTFLVLFPLATL
QLDGDQSADHQAEKRDQDQSR
QNGNLKRALKR
DVKCIGSCDSTVWHRV
P05900 Di6.8 precursor M superfamily Conus distans
MLKVGVVLLALLLLVPLVAP
EQDEGKWTMLAKNENTVKRKL
MDFMAR
ECDPYYCSNGKVCCPDYPTCGDSTGKLICVRVTD
P04814 Eb2C01 precursor M superfamily Conus ebraeus
MLKMGVVMLFTFLVLFPLAT
LQLDADQPADRDAENKQDLNP
DGRRGIILPALRR
FCFFTITNMSGGCLV
P04793 Eb2C03 precursor M superfamily Conus ebraeus
MMLKMRAVLFTFLVLFPLATFQLDA
DQPVERNAENKQDLNP
DKRREIILPALRLQAR
RSCSFPSNTWC
K
P05115 Eb2C04 precursor M superfamily Conus ebraeus
MMLKMRAVLFTFLVLFPLATFQLDA
DQPVERNAENKQDLNP
DKR
REIILPALRLQTSSDCLGFPDVWC
K
P04792 Eb2C07 precursor M superfamily Conus ebraeus
MMLKLSVVLFILLVLFPMATL
QLDADQPVERYVENKENLNP
DERR
EIILPALRVQSFIACTMGWC
K
P04813 Eb2C11 precursor M superfamily Conus ebraeus
MLKMGVVMLFTFLVLFPLAT
LQLDADQPADRDAENKQDLNP
DGRR
GIILSALRSPNSCVWSPPCHLPSERMTAFTANNAALE
LPYSGLVAPEQ
P04811 Eb2C12 precursor M superfamily Conus ebraeus
MLKMGVVMLFTFLVLFPLAT
LQLDADQPADRDAENKQDLNP
DGGRGIILPALRSQR
SCNWSSLCDPPSERMTAFTANNAALE
LPYSGLVAPEQ
P04812 Eb2C12 precursor M superfamily Conus ebraeus
MLKMGVVMLFTFLVLFPLAT
LQLDADQPADRDAENKQDLNP
DGRRGIILPALRSQR
SCNWSSLCDPPSERMTAFTANNAALE
LPYSGLVAPEQ
P04794 Eb2C12 precursor M superfamily Conus ebraeus
MLKMGVVMLFTFLVLFPLATL
QLVADQPADRDAENKQDLNP
DGRRGIILPALRSQR
SCNWSSLCDPPSERMTAFTANNAALE
LPYSGLVAPEQ
P04696 Eb3-2-I01 precursor M superfamily Conus ebraeus
MMLKMGVVLFVFLVLFPLATL
QLNADQHVKRYAENKQDLNP
DERKGLVSLDLR
LPCCDVGWCSRRCICDVYRP
P04715 Eb3-2-N01 precursor M superfamily Conus ebraeus
MMLKMGVVLFVFLVLFPLATL
QLNADQHVKRYAENKQDLNP
DERKGLVSLDLR
LPCCDVGWCSRRCNCDVYRP
P04730 Eb3-2-N02 precursor M superfamily Conus ebraeus
MMLKMGVVLFVFLVLFPLATL
QLNADQHVKRYAENKQDLNP
DERKGLVSLDLR
LPCCYIGWCSRRCNCGGYRP
P04731 Eb3-2-N03 precursor M superfamily Conus ebraeus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERDAENKQDNPD
ERKGFVSLALR
RPCCYIGWCSRRCNCGGYRP
P04694 Eb3-2-R03 precursor M superfamily Conus ebraeus
MMLKMGVVLFVFLVLFPLATL
QLNADQHVKRYAENKQDNPD
ERKGFVSLALR
RPCCSLRWCSNYCRCGI
P04695 Eb3-2-R03 precursor M superfamily Conus ebraeus
MMLKLRVVLFILLVLFPLATLQLDA
DQPVERDAENKQDNPD
ERKGFVSLALR
RPCCSLRWCSNYCRCGI
P04716 Eb3-D04 precursor M superfamily Conus ebraeus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYAENKQDLHP
NERTGFILPAMRRQ
GCCIEPLCYQYDCDCCRHL
P04734 Eb3-H01 precursor M superfamily Conus ebraeus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERDAENKQDLHP
DERTGFMLSAVGRR
CCSLRRCEPHCHCCVQRH
P04733 Eb3-H03 precursor M superfamily Conus ebraeus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYAENKQDLHP
NERTGFILPAMRRR
CCRLRRCKTHCHCCVYRP
P04732 Eb3-H03 precursor M superfamily Conus ebraeus
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERDAENKQDLHP
DERTGFILPAMRRR
CCRLRRCKTHCHCCVYRP
P04836 Eb3-IP01 precursor M superfamily Conus ebraeus
MMSKLGVLLTICLLLFPITG
LPLDEDQPADLPALRTQDFEP
EHSPWFDPVRR
CCSQNCLTCIPCCPY
P04838 Eb3-KP02 precursor M superfamily Conus ebraeus
MSKLGALLIICLLLFSLTA
VPLDGDQHADQPAQRLQDRIPT
EDHPLFDPNKR
CCPPVACNMGCKPCC
G
P04879 Eb3-KP02 precursor M superfamily Conus ebraeus
MMSKLGALLTICLLLFSLTA
VPLDGDQHADQPAQRLQDRIP
TEDHPLFDPNKR
CCPPVACNMGCKPCC
G
P04822 Eb3-KP04 precursor M superfamily Conus ebraeus
MSKLGALLIICLLLFPHTAVP
LDGDQPADQPAERLQDDISS
EHHPMFNSIRRREQSQFKSFTSVKLLDSRGER
CCGPTACLA
GCKPCC
G
P04911 Eb3-KP04 precursor M superfamily Conus ebraeus
MSKLGVLLTICLLLFPHTAVP
LDGDQPAERLQDDISSEHHP
MFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACLAGCKP
CC
G
P04848 Eb3-KP04 precursor M superfamily Conus ebraeus
MMSKLGVLLTICLLLFPHTAVP
LDGDQHADRPAERLQDDIS
SEHHPMFDAVKRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
P04736 Eb3-R02 precursor M superfamily Conus ebraeus
MMLKMRAVLYVFLVLFPLATLQLDA
DQPVERYAENKQDLNP
DGKR
EFILPAVGRTCCDLTWCDGNCRCCTP
R
P04750 Eb3-T01 precursor M superfamily Conus ebraeus
MLKMGVVLFIFLVLSPLATL
QLDADQPVERYAENKQLLSPD
ERREIILHALGTR
CCSWDVCDHPSCTCC
G
P04800 Ec2C01 precursor M superfamily Conus emaciatus
MLKMGVVLFIFLVLFPLAT
LQLDAEQRVERYVDNKQDLNPE
ERKEITMADLRRATERR
CPFWIC
P04845 Ec3-GMAR01 precursor M superfamily Conus emaciatus
MMSKLGVLLTICVLLFPLTA
VPLDGDQPADQPAERTQNEQH
PLFDQKR
GCCRWPCPSICGMARCCSS
P04872 Ec3-IP01 precursor M superfamily Conus emaciatus
MMYKFGVLLTICLLLFPLTAVQL
DGDQPVDLPALRTQDFAP
EHSPWFNPVKR
CCSRHCWVCIPCCPNGS
P04847 Ec3-IP03 precursor M superfamily Conus emaciatus
MMSKLGVLLTICLLLFPITG
LPLDEDQHDDLPALRAQDFEP
EHSPWFDPVRR
CCSQDCSVCIPCCPN
P04831 Ec3-TP01 precursor M superfamily Conus emaciatus
MSKLGALLIICLLLFPLTA
VPMDGDQPADQPAERMQDDISS
EHHPMFDAIR
GCCGAFACRFGCTPCC
P05111 Ec3-TP01-2 precursor M superfamily Conus emaciatus
MSKLGALLIICLLLFPLT
AVPMDGDQPADQPAERMQDDISF
EQHPMFDATR
SCCNAGFCRFGCTPCCY
P04908 Ec3-TYN01 precursor M superfamily Conus emaciatus
MMSKLGALLTICLLLFPITG
LPLDEDQPADLPALRMEDFAP
EHSPLFDPVKR
CCILCWKCTYNCCRAW
P04697 Ec3-YDG04 precursor M superfamily Conus emaciatus
MLKMGVVLFTFLVLFPLAT
LQLDADQPAARYAENKQDLNPN
ERKEMMLSALRQR
ACCDPDWCDAGCYDGCC
P04809 Ec3-YDG04 precursor M superfamily Conus emaciatus
MLKMGVVLFTFLVLFPLAT
LQLDADQPAARYAENKQDFNPN
ERKEMMLSALRQR
ACCDPDWCDAGCYDGCC
P05909 Eu001 precursor M superfamily Conus eburneus
MSKLGVVLFIFLVLFPMATL
QLDGDQPADRRADEKDQDLTQ
QYLNLRRVLQR
GLVCTHVRPYHNAVWS
P04566 Eu3.1 precursor M superfamily Conus eburneus
MMSKLGVLLTICLLLFPLTAV
SLDGDQPADLPELRAQDFAP
ERSPWFDPVRR
CCSQDCSVCIPCCPW
P04549 Eu3.2 precursor M superfamily Conus eburneus
MMSKLGVLLTICLLLFPLTAVQL
DGDQPADLPALRAQDFAP
ERSPWFDPVKR
CCSQDCWVCIPCCPN
P04550 Eu3.3 precursor M superfamily Conus eburneus
MMSKLGVLLTICLLLFPLT
ALPMDGDQPQERKEDGKSAALQ
PWFDPVKR
CCQAACSPWLCLPCC
G
P04551 Eu3.4 precursor M superfamily Conus eburneus
MMSKLGVLLTICLLLFPLTALP
MDGDQPQERKEDGKSAALQ
PWFDPVKR
CCRAACSPWLCLPCC
G
P04562 Eu3.5 precursor M superfamily Conus eburneus
MMSKLGVLLTICLLLFPLTAVPL
DGDQPADQPAERMQDDIS
SEQHPFFDPVKR
CCVVCNAGCSGNCCP
P03856 Eu5 precursor M superfamily Conus eburneus
MSKLGVVLLIFVVLLALTS
PHHYGNRFAGYQARQMGVQQRK
NALANAVRRS
GCGYLGEPCCISPKRAYCHGDLECNNVAMCV
N
P06023 Fla-14 precursor M superfamily Conus flavidus
MMSKLGVLLTICLLLFPLTA
VQLDGEQPVDLLALRTQDFAP
EQSPWFDPVKR
GCSMYCWKCFPCCPN
G
P06020 Fla-15 precursor M superfamily Conus flavidus
MLKMGVMLFTFLVLFHLAAPQLDA
DQPVARYAGNKPDFNPN
KRMKMMSALRKR
GCCPPSLCDPGCDEGCCPVVTPAC
P06022 Fla3.2 precursor M superfamily Conus flavidus
MLKMRVVLFTFRVLFPLATLQLDA
DQPRARYAENKQDFNRN
ERTKMILSAVSASMGRQRR
CCLWPECGGCVCCY
P06021 Fla3.2 precursor M superfamily Conus flavidus
MLKMRVVLFTFLVLFPLATLQLDA
DQPRARYAENKQDFNRN
ERTKMILSAVSASMGRQRR
CCLWPECGGCVCCY
P06024 Fla3.4 precursor M superfamily Conus flavidus
MMSKLGVLLTISLLLFPLTA
VQLDGEQPVDLLALRTQDFAP
EQSPWFDPVKR
CCSKYCWECTPCCPYSS
G
P06025 Fla3.5 precursor M superfamily Conus flavidus
MMSKLGVLLTVCLLLFPLTA
LRLVRDQPAERPAKRTQDDIP
NGQDPLIDR
QINCCPWPCPDSCHYQCCH
P01464 GIIIA precursor M superfamily Conus geographus (Geography cone)
MSKLGVLLTICLLLFPLTA
LPMDGDEPANRPVERMQDNISS
EQYPLFEKR
RDCCTPPKKCKDRQCKPQRCCA
GR
P05726 GIIIB precursor M superfamily Conus geographus (Geography cone)
MMSKLGVLLTICLLLFPLTA
LPMDGDEPANRPVERMQDNIS
SEQYPLFEKR
RDCCTPPRKCKDRRCKPMKCCA
GR
P04883 Gm3-WP04 precursor M superfamily Conus gloriamaris
MMSKLGALLTICLLLFSLTA
VPLDGDQHADQPAERLHDRLP
TENHPLYDPVKR
CCDDSECDYSCWPCCMF
G
P03400 Im6.7 precursor M superfamily Conus imperialis
MSKLGVVLFTLLLLVPLVTP
ERDGGKWTMLAKNKKAMKRNL
MDFITR
TCDPYYCNDGKVCCPEYPTCGDSTGKLICVRVTD
P05911 Im9.13 precursor M superfamily Conus imperialis
MLKVGVVLLIFLVLMSSA
IPQDRDFSGQQSDKKQIRQRDIF
GSKMRRYSPNIQRR
CIVGTPCHVCRSQSKSCNGWLEKQRYC
GYC
G
P01694 KIIIA precursor M superfamily Conus kinoshitai
CCNCSSKWCRDHSRCC
GR
P04710 Lp3-Y02 precursor M superfamily Conus leopardus
MLKMGVVLFTFLILFPLVTL
QLDADQRVERYAENKQDLNPE
ERREIKLLALRQR
CCIGPKCMEECYCCV
P01058 Lp3.1 precursor M superfamily Conus leopardus
MLKMGVLLFIFLVLFPLTTL
ELDTDRPVERHAAIKQDLKPQ
ERRGIRLHAPR
DECCEPQWCDGACDCCS
P01080 Lp3.2 precursor M superfamily Conus leopardus
MLKMGVVLFTFLVLFPLATLQLDA
DQPVERYAENKQDLNPN
ERMKMIMSALGQRR
CCISPACHEECYCCQ
P01171 Lt0.3 precursor M superfamily Conus litteratus
MSKLGVVLFIFLVLFPMATLQLD
GDEKDLTQQYLNLRRVLQ
R
GLVCAHASPYHNAVWS
P01168 Lt0.4 precursor M superfamily Conus litteratus
MSKLGVVLFIFLVLFPMATLQLD
GDQPADRRADEKDLTQQY
LNLRRVLQR
GLVCAHASPYHNAVWS
P01169 Lt0.5 precursor M superfamily Conus litteratus
MSKLGVVLFIFLVLFPMATLQLD
GDQPADRRADEKDQDLTQ
QYLNLRRVLQR
GLVCAHVRPYHNSMWS
P03854 Lt10 precursor M superfamily Conus litteratus
MSKLGVVLLIFVVLLALTS
PHHYGNRFAGYQARQMGVQQRK
NALANALRRS
GCGYLGEPCCVAPKRAYCHGDLECNNIAMCV
N
P04557 Lt3.6 precursor M superfamily Conus litteratus
MMSKLGVLLTICLLLFPLT
ALPMDGDQPVDRPAER
MQGKIS
SEQHPMFDPIEGCCTQSCTTCFPCCLI
P04558 Lt3.7 precursor M superfamily Conus litteratus
MMSKLGVLLTICLLLFPLT
ALPMDGDQPQERKEDGKSAALQ
PWFDPVKR
CCQAACSPWPCLPCC
R
P04559 Lt3.8 precursor M superfamily Conus litteratus
MMSKLGVLLTICLLLFPLTALT
KEGDQPVGRPAER
QHGKIS
SEQHTMFDPIEGCCQQSCTTCFPC
P01163 LtIIIA precursor M superfamily Conus litteratus
MLKMGVLLFTFLVLFPLTTLELD
TDRPVERHAAIKQDLKPQ
ERRGIRLHAPR
DECCEPQWCDGACDCCS
P01164 LtIIIB precursor M superfamily Conus litteratus
MLKIGVVLFTFLVLFPLATLQLDA
DQPVERYAENKQDLNPN
ERMKMIMSALGQRR
CCISPACHEECYCCQ
P01165 LtIIIC precursor M superfamily Conus litteratus
MLKIGVVLFTLLVLFPLATLQLDA
DQPVERYAENKQDLNPN
ERMKMIMSALGQRR
CCISPACHEECYCC
P01166 LtIIID precursor M superfamily Conus litteratus
MLKMGVLLFTFLVLFPLAMFQLDA
DQPVERYAENKQDLNRD
ERMKIMLSALRQRQ
CCDWEWCDELCSCCW
P01167 LtIIIE precursor M superfamily Conus litteratus
MMSKLGALLTICLLLFPLTA
VPLDGDQPLDRHAERMHDGIS
PKRHPWFDPVKR
CCKVQCESCTPCC
P01170 LtXVIA precursor M superfamily Conus litteratus
MPKLGVSLFIFLVLFPLATLQLD
GDQSAGRHAQERGEDLFK
MYQYLRRALERRR
TGEDFLEECMGGCAFDFCCKR
SLRDTTS
D
P04806 Lv3-1-DEG01 precursor M superfamily Conus lividus
MLKMGVMLFTFLVQFHLAAPQLDA
DQPVARYAGNKPDFNPN
KRMKMMSALRKR
GCCPPSLCDPGCDEGCCPVVTPAC
P04805 Lv3-1-DEG01 precursor M superfamily Conus lividus
MLKMGVMLFTFLVLFHLAAPQLDA
DQPVARYAGNKPDFNPN
KRMKMMSALRKR
GCCPPSLCDPGCDEGCCPVVTPAC
P04782 Lv3-D01 precursor M superfamily Conus lividus
MLKMRVVLFTFLVLFPLATLQLDA
DQPRARYAENKQDFNRN
ERTKMILSAVSASMDRQRR
CCFWPMCGGCDCCYL
P04784 Lv3-D01 precursor M superfamily Conus lividus
MLKMRVVLFTFLVLFPLATLQLDA
DQPRARYAENKQDFNRN
ERTKMILSAVSASMGRQRR
CCFWPMCGGCDCCYL
P04781 Lv3-D02 precursor M superfamily Conus lividus
MLKMRVVLFTFLVLFPLATLQ
QDADQPRARYAENKQDFNRN
ERTKMILSAVSASMGRQRR
CCFWPMCRGCDCCYL
P04864 Lv3-IP01 precursor M superfamily Conus lividus
MMSKLGVLLTICLLLFPLTAVQL
DGDQPVDLPALRTQDFAP
EHSPWFDPVKR
CCSRDCWVCIPCCPNGSA
P04891 Lv3-IP02 precursor M superfamily Conus lividus
MMSKLGVLLTICLLLFPLTAVQL
DGDQPVDLPALRTQDFAP
EHSPWFDPVKR
CCSRHCWVCIPCCPNGSA
P04778 Lv3-V02 precursor M superfamily Conus lividus
MLKMGVVLFTFLVLFPLAT
LQLDADQPRARYAENKQDFNRN
ERTKMILSAVSASMGRQRR
CCLWPECGGCVCCYL
P04779 Lv3-V03 precursor M superfamily Conus lividus
MLKMGVVLFTFLVLFPLAT
LQLDADQPRARYAENKQDFNRN
ERTKMILSAVSASMGRQRR
CCIWPECGSCVCCL
P04769 Lv3-V04 precursor M superfamily Conus lividus
MLKMGVVLFTFLVLFPLAT
LQLDADQPRARYAENKQDFNRN
ERTKMILSAVSASMGRQRR
CCLWPACWGCVCCY
P04785 Lv3-V05 precursor M superfamily Conus lividus
MLKMRVVLFTFLVLFPLATLQ
QDADQPRARYAENKQDFNRN
ERTKMILSAVSASMGRQRR
CCFWPACWGCVCCY
P04772 Lv3-V07 precursor M superfamily Conus lividus
MLKMGVVLFTFLVLFPLAT
LQLDADQPRARYAENKQDFNRN
ERTKMILSAVSASMGRQRR
CCLWPECGGCVCCY
P04770 Lv3-V07 precursor M superfamily Conus lividus
MLKMRVVLFTFLVLFPLATLQLDA
DQPRARYAENKQDFNRN
ERTKMILSAVSASMGRQRR
CCLWPECGGCVCCY
P04780 Lv3-Y01 precursor M superfamily Conus lividus
MLKMGVVLFTFLVLFPLAT
LQLDADQPRARYAENKQDFNRN
ERTKMILSAVSASMGRHRR
CCFWPDCRGCYCCL
P04699 Lv3-Y02 precursor M superfamily Conus lividus
MLKMGVMLFTFLVLFHLAAPQLDA
DQPVARYAGNTPDFNPN
ERMKMMLSALRQR
RCCISPACHKDCYCCL
P04802 Lv3-YH01 precursor M superfamily Conus lividus
MLKMRVVLFTFLVLFPLATLQLDA
DQPVARYAENKQNFNPN
ER
MKMMLPALRQQPCCSPSTCDGGCYHCC
P04801 Lv3-YH02 precursor M superfamily Conus lividus
MLKMGVVLFTFLVLFPLSTLQLNA
DQHVARYAENKQNFNPN
ER
TKMMLPALRQQPCCSPSTCDGGCYHCC
P04804 Lv3-YH04 precursor M superfamily Conus lividus
MLKMGVMLFTFLVLFPLATL
QMDADQPVARYAENKQNLNPN
ER
MKLMLSALRQQECCKPSTCDGGCYHCC
P04803 Lv3-YH05 precursor M superfamily Conus lividus
MLKMGVMLFTFLVLFPLATL
QMDADQPVARYAENKQNLNPN
ER
MKLMLSALRQQTCCEPSTCDGGCYHCC
P04765 Mi3-D01 precursor M superfamily Conus miles
MLKMGVVLFVFLVLFPLAT
LQLDADQPVERYVENKQDLNAD
ER
MGLILPALRQQSCCDIQWCYDNCDCCI
P04791 Mi3-E03 precursor M superfamily Conus miles
MSKLGVVLFIFLVLFTMATLQLD
ADQPVDRYAENKQNLNPG
ERRKATRRVRR
DCCSLSACVPPPACECC
K
P04790 Mi3-E04 precursor M superfamily Conus miles
MSKLGVVLFIFLVLFTMATLQLD
ADQPVDRYAENKQNLNPG
ERRKATRRVRR
DCCSMSACVPPPACECC
K
P04832 Mi3-IP02 precursor M superfamily Conus miles
MMSKLGVLLTICLLLFPITA
DPLVEDQPADRPADRMQDIAT
EQHPLFDPVKR
CCDWPCGIGCIPCCLP
P04874 Mi3-QDML01 precursor M superfamily Conus miles
MMFKLGVLLTICLVLFPLTA
LPLDGDQPADRPAERMQDDTS
AAQNPRVAFVER
CCEADCPMCQDMLCC
RK
P04749 Mi3-T02 precursor M superfamily Conus miles
MLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLSPD
ERREIILHALGTR
CCSWDVCDHPSCTCC
G
P04830 Mi3-TP01 precursor M superfamily Conus miles
MMSKLGALLIICLLLFPLTA
VPLDGDQPADRPAERMQNDIS
SEHHPMFDAIR
GCCGAFACRFGCTPCC
P04771 Mi3-V01 precursor M superfamily Conus miles
MLKMGVVLFTFLVLFPLAT
LQLDADQPRARYAENKQDFNRN
ERTKMILSAVSASMGRQRR
CCLWPECGGCVCCY
P04843 Mi3-VYPT01 precursor M superfamily Conus miles
MMFKLGVLLTICLVLFPLTA
LPLDGDQPADRPAERAQDDTS
AAQNPRVDHVKR
CCSICDTTCVYPTCCDDLISD
K
P06170 Mr012 precursors M superfamily Conus marmoreus
MGVVLFIVLVLFPLATLQLDA
DKPVERYAENKQLLNPDERR
GIILHALGQR
VCCSFGSCDSLCQCCDGLAPNIHGAVLGGFI
RTMSAFVDFTYHCATSLV
P06171 Mr013 precursor M superfamily Conus marmoreus
MLKMGVVLFIFLVLFPLATL
QLDADQPVERYAKNKQLFNPH
KRRGIILRAPGKR
CCHWNWCDHLCLCCGS
P06172 Mr014 precursor M superfamily Conus marmoreus
MLKMGVVLFTFLVLFPLATLQLDA
DQPVERYAGNKQDLNPE
ERR
GFILHALWHVQCCSWLWCDGGCDCCE
P06176 Mr018 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DQPVERYAENKQLLNPD
ERRGIILHALGQR
VCCPFGGCHELCTAATVSAEHPWRCAGR
FIQQRQRLLISCIIAPRLLSKNDEHDCTLVQISCSF
P06178 Mr020 precursor M superfamily Conus marmoreus
MMSKLGVLLTICLLLFALTAVPLDG
DQPADRPAERMQDDIS
SERHPMFDAVR
DCCPLPACPFGCNPCCGWPALLSGPHQVMN
NE
P05417 Mr034 precursor M superfamily Conus marmoreus
MMSKLGVLLTICLLLFALTAVPLDG
DQPADRPAERMQDDIS
SERHPMFDAVR
DCCPVAGMPLWMQPLLWMTSFVIGTSSSNE
P05419 Mr035 precursor M superfamily Conus marmoreus
MMSKLGVLLTICLLLFPLTA
VPLDGDQPADRPAERMQDDIS
SERHLFLIAANSVAIWRHAASDVR
LVVGDQLCYRVLIKCLM
NK
P05510 Mr038 precursor M superfamily Conus marmoreus
MSKLGVVLFTFLLLFILATP
KPIQDQPADRNAEPRGKIRDR
KNEFLTHTFSWHPTWCPWC
G
P06200 Mr061 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DKPVERYAENKQLLNPD
ERRGIILHALGQR
VCCPFGGCHEFCLCCD
G
P06201 Mr062 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DKPVERYAENKQLLNPD
ERRGIILHALGQR
VCCPFGGCHELCLCSD
G
P06202 Mr063 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DKPVERYAENKQLLNPD
ERRGIILHALGQR
VCCRKEWCHARCTCC
G
P06203 Mr064 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DKPVERYAENKQLLNPD
ERRGIILHALGQR
VCCSFGSCDNLCQCCD
G
P06204 Mr065 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DKPVERYAENKQLLNPD
ERRGIILHALGQR
VCCSFGSCDSLCQCCDC
P06205 Mr066 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DKPVERYAENKQLLNPD
ERRGIILHALGQR
VCCSFGSCDSLCQCRD
G
P06208 Mr069 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DQPVERYAENKQLLNPD
ERRGIILHALGQR
VCCPFGGCHELCYCCY
G
P05430 Mr1.9 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DQPVERYAENKQLLNPD
ERRGIILHALGQR
VCCPFGGCHELCTADD
G
P05907 Mr106 precursor M superfamily Conus marmoreus
MSKLGVVLFIFLVLFPMATL
QLDGDQSADHQADKRDQDQSR
QNGNLKRALKRDVR
CIGSCDSTVWHRV
P05906 Mr107 precursor M superfamily Conus marmoreus
MSKLGVVLFIFLVLFPLATFQ
LDGDQSADHQADKRDQDQSR
QNGNLKGALKR
DVKSIGSWDFTVWHRV
P05438 Mr1e precursor M superfamily Conus marmoreus
MLKMGVVLFIFLVLFPLATL
QLDADQPVERHAENKQLLNPD
ERRGIILHALRKR
CCHSSWCKHLC
P03855 Mr2 precursor M superfamily Conus marmoreus
MSKLGVVLLIFVVLLALTS
PHHYGNRFAGYQARQMGVQQRK
NALANALRRS
GCGYLGEPCCVAPKRAYCHGDLECNSVAMCV
N
P04852 Mr3-KPAR01 precursor M superfamily Conus marmoreus
MMSKLGVLLTICLLLFPVTA
LPMDGDQPADRLVERMQDNIS
SEQHPFFEKRRG
GCCTPPRKCKDRACKPARCCGP
G
P04561 Mr3.10 precursor M superfamily Conus marmoreus
MMSKLGVLLTICLLLFPLT
ALPMDGDQPADRPAERMQNDIS
SERHPFFDR
SKQCCHLAACRFRCTPCCW
P05415 Mr3.11 precursor M superfamily Conus marmoreus
MMSKLGILLTICLLLFPLTA
VPLDGDQPADRPAERMQDDIS
SEHHPFFDPVKR
CCRIACNLKCNPCC
G
P05421 Mr3.12 precursor M superfamily Conus marmoreus
MLKMGVLLFTFLVLFPLATLQLDA
DQPVERYVENKQDLNPD
ERREIILHALGQR
LCCWKEWCHARCTCC
GSANIHGAVLGGF
IHNNSVC
P05423 Mr3.13 precursor M superfamily Conus marmoreus
MLKMGVVLFTFLVLFPLATLQLDA
DQPVERYVENKQDLNPD
GRREIILHALGQR
LCCWIHWCHARCTCC
G
P05425 Mr3.14 precursor M superfamily Conus marmoreus
MLKMGVVLFIFLVLFTLPTLQLDA
DQLVERHVENKQLLNPD
ERRRIISDALGQR
ICCPQGGCHQLCQCCGC
P06261 Mr3.14 precursor M superfamily Conus marmoreus
MLKWSGAIHFLVLFTLPTLQLDA
DQLVERHVENKQLLNPDE
RRRIISDALGQR
ICCPQGGCHQLCQCCGC
P06262 Mr3.14 precursor M superfamily Conus marmoreus
MLKWSVLFIFLVLFTLPTLQLDA
DQLVERHVENKQLLNPDE
RRRIISDALGQR
ICCPQGGCHQLCQCCGC
P05427 Mr3.15 precursor M superfamily Conus marmoreus
MLKMGVVLFIFLVLFTLPTLQLDA
DQLVERHAENKQLLNPD
ERRRIISVALGQR
VCCPHGGCHQICQCCGC
P06179 Mr3.16 precursor M superfamily Conus marmoreus
MQVALGLEEGWREVRDVENLGVVLFIVLVLFPLATLQLDA
D
KPVERYAENKQLLNPDERRGIILHALGQR
VCCSFGSCDSLC
QCCD
G
P05432 Mr3.16 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DKPVERYAENKQLLNPD
ERRGIILHALGQR
VCCSFGSCDSLCQCCD
G
P06169 Mr3.16 precursor M superfamily Conus marmoreus
MGVVLFIFLVLFPLATLQLDA
DKPVERYAENKQLLNPDERR
GIILHALGQR
VCCSFGSCDSLCQCCD
G
P06199 Mr3.16 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DKPVERYAENKQLLNPD
ERREVILHALGQR
VCCSFGSCDSLCQCCD
G
P06207 Mr3.16 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DKPVERYVENKQLLNPD
ERRGIILHALGQR
VCCSFGSCDSLCQCCD
G
P06211 Mr3.16 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVQFPLATL
QLDADKPVERYAENKQLLNPD
ERRGIILHALGQR
VCCSFGSCDSLCQCCD
G
P06210 Mr3.16 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLVTL
QLDADKPVERYAENKQLLNPD
ERRGIILHALGQR
VCCSFGSCDSLCQCCD
G
P05434 Mr3.17 precursor M superfamily Conus marmoreus
MLKMGVVLFIFLVLFTLPTLQLDA
DQPVERYAENKQLLNPD
ERRTIILHALTQP
VCCPFGECKSLCYCCGA
P05436 Mr3.18 precursor M superfamily Conus marmoreus
MLKMGVVLFIFLVLFPLATL
QLDADQPVERYAKNKQLFNPH
KRRGIILRAPGKR
CCHRNWCDHLCSCCGS
P01470 Mr3.3 precursor M superfamily Conus marmoreus
MSRLGVLLTICLLLFPLTA
VPLDGDQPADRPAERLQDDISS
EHHPHFDSGR
ECCGSFACRFGCVPCCV
P05413 Mr3.3 precursor M superfamily Conus marmoreus
MMSKLGVLLTICLLLFPLTA
VPLDGDQPADRPAERLQDDIS
SEHHPHFDSGR
ECCGSFACRFGCVPCCV
P05412 Mr3.3 precursor M superfamily Conus marmoreus
MMSKLGVLLTICLLLFPLTA
VPLDGDQPADRPAERLQDDIS
SEKQITNTPILDSGR
ECCGSFACRFGCVPCCV
P01469 Mr3.4 precursor M superfamily Conus marmoreus
MSKLGVLLTICLLLFPLTA
VPLDGDQPADRPAERMQDDISS
ERHPFFDR
SKQCCHLPACRFGCTPCCW
P01468 Mr3.5 precursor M superfamily Conus marmoreus
MSKLGVLLTICLLLFPLTA
LPLDGDQPADQRAERTQAEKHS
LPDPR
MGCCPFPCKTSCTTLCC
G
P06168 Mr3.8 precursor M superfamily Conus marmoreus
MGVGLFIFLVLFPLATLQLDA
DQPVERYAKNKQLFNPHKRR
GIILRAPGKR
CCHWNWCDHLCSCCGS
P01082 Mr3.8 precursor M superfamily Conus marmoreus
MLKMGVVLFIFLVLFPLATLQLDA
DQPVERYAKNKQLFNPH
KRRGIILRAPGKR
CCHWNWCDHLCSCCGS
P06194 Mr3.8 precursor M superfamily Conus marmoreus
MGVVLFIFLVLFPLATLQLDA
DQPVERYAKNKQLFNPHKRR
ESYCVRPGKR
CCHWNWCDHLCSCCGS
P06212 Mr3.8 precursor M superfamily Conus marmoreus
MLKMGVVLFIFLVLFPLATL
QLDADQPVERYAKNKQLFNPH
KRRGIILRASGKR
CCHWNWCDHLCSCCGS
P06214 Mr3.8 precursor M superfamily Conus marmoreus
MLKMGVVLFIFLVLFTLA
TLQLDADQPVERYAKNKQLFNPH
KRRGIILRAPGKR
CCHWNWCDHLCSCCGS
P06218 Mr3.8 precursor M superfamily Conus marmoreus
MLKIGSGAIHLLVLFPLATLQLDA
DQPVERYAKNKQLFNPH
KRRGIILRAPGKR
CCHWNWCDHLCSCCGS
P06219 Mr3.8 precursor M superfamily Conus marmoreus
MSKLGVVLCIFLVLFPLATLQLDA
DQPVERYAKNKQLFNPH
KRRGIILRAPGKR
CCHWNWCDHLCSCCGS
P06221 Mr3.8 precursor M superfamily Conus marmoreus MFLFKIWV
VVLFIFLVLFPLATL
QLDADQPVERYAKNKQLF
NPHKRRGIILRAPGKR
CCHWNWCDHLCSCCGS
P06216 Mr3.8 precursor M superfamily Conus marmoreus
MLKMGVVLLIFLVLFPLATL
QLDADQPVERYAKNKQLFNPH
KRRGIILRAPGKR
CCHWNWCDHLCSCCGS
P06215 Mr3.8 precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DKPVERYAENKQLFNPH
KRRGIILRAPGKR
CCHWNWCDHLCSCCGS
P06213 Mr3.8 precursor M superfamily Conus marmoreus
MLKMGVVLFIFLVLFPLATL
QLDADQPVKRYAKNKQLFNPH
KRRGIILRAPGKR
CCHWNWCDHLCSCCGS
P06220 Mr3.8 precursor M superfamily Conus marmoreus
MFVKLGSWLLFIFLVLFPLATLQLDA
DQPVERYAKNKQLFN
PHKRRGIILRAPGKR
CCHWNWCDHLCSCCGS
P06195 Mr3.8 precursor M superfamily Conus marmoreus
MGVVLFIFLVLFPLATLQLDA
DQPVERYAKNKQLFNPHKR
R
GIILCAPGKRCCHWNWCDHLCSCCGS
P06198 Mr3.8 precursor M superfamily Conus marmoreus
MLKMGVVLFIFLVLFPLATL
QLDADQPVERYAKNKQLFNPH
KRRGTILRAPGKR
CCHWNWCDHLCSCCGS
P06197 Mr3.8 precursor M superfamily Conus marmoreus
MLKMGVVLFIFLVLFPLATL
QLDADQPVERYAKNKQLFNPH
KRRGIISRAPGKR
CCHWNWCDHLCSCCGS
P04560 Mr3.9 precursor M superfamily Conus marmoreus
MMSKLGVLLTICLLLFPLT
ALPMDGDQPADRPAERMQDDIS
SERHPFFDR
SEQCCHLAACRFGCTPCCW
P03857 Mr6 precursor M superfamily Conus marmoreus
MSKLGVVLLIFVVLLALTS
PHHYGNRFAGYQARQMGVQQRK
NALANALRRS
GCGYLGEPCCVAPKRAYCHGDLECNNVAMCV
N
P06225 MrIIIB precursor M superfamily Conus marmoreus
MMSKLGVLLTICLLLFPLTA
VPLDGDQPADRPAERMQDDIS
SERHLFFDR
SKQCCHLAACRFGCTPCCW
P05414 MrIIIB precursor M superfamily Conus marmoreus
MMSKLGVLLTICLLLFPLTA
VPLDGDQPADRPAERMQDDIS
SERHPFFDR
SKQCCHLAACRFGCTPCCW
P06177 MrIIID precursor M superfamily Conus marmoreus
MMSKLGILLTICLLLFPLTA
VPLDGDQPADRPAERMQDDIS
SEHHPFFDPFKR
CCRLSCGLGCHPCC
G
P06226 MrIIID precursor M superfamily Conus marmoreus
MMSKLGILLTICLLLFPLTA
VPLDGDQPADRPAERMQDDIS
SEHHPLFDPVKR
CCRLSCGLGCHPCC
G
P01471 MrIIID precursor M superfamily Conus marmoreus
MMSKLGILLTICLLLFPLTA
VPLDGDQPADRPAERMQDDIS
SEHHPFFDPVKR
CCRLSCGLGCHPCC
G
P06222 MrIIID precursor M superfamily Conus marmoreus
MMSKLGILLTICLLLFPLTA
VPLDGDQPADRPAERMQDDIS
SEHHSLFDPVKR
CCRLSCGLGCHPCC
G
P06223 MrIIID precursor M superfamily Conus marmoreus
MMSKLGILLTICLLLFPLTA
VPLDGDQPADRPAERMQVDIS
SEHHPFFDPVKR
CCRLSCGLGCHPCC
G
P06196 MrIIIE precursor M superfamily Conus marmoreus
MGVVLFIVRVLFPLATLQLDA
DQPVERYAENKQLLNPDERR
GIILHALGQR
VCCPFGGCHELCYCCD
G
P01081 MrIIIE precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DQPVERYAENKRLLNPD
ERRGIILHALGQR
VCCPFGGCHELCYCCD
G
P05429 MrIIIE precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DQPVERYAENKQLLNPD
ERRGIILHALGQR
VCCPFGGCHELCYCCD
G
P06209 MrIIIE precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DQPVERYVENKQLLNPD
ERRGIILHALGQR
VCCPFGGCHELCYCCD
G
P06175 MrIIIE precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DQPVERYAENKQLLNPD
ERRGIILHALGQRVCCPFGGCNMIPLLSSGLRRGIILHALG
QR
VCCPFGGCHELCYCCD
G
P06173 MrIIIF precursor M superfamily Conus marmoreus
MLKMGVVLCIVLVLFPLATLQLDA
DKPVERYAENKQLLNPD
ERRGIILHALGQR
VCCPFGGCHELCLCCD
G
P06206 MrIIIF precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLATLQLDA
DKPVERYAENKQLLNPD
ERRGIVLHALGQR
VCCPFGGCHELCLCCD
G
P04527 MrIIIF precursor M superfamily Conus marmoreus
MLKMGVVLFIVLVLFPLAT
LQLDADKPVERYAENKQLLNPD
ERRGIILHALGQR
VCCPFGGCHELCLCCD
G
P01466 MrIIIG precursor M superfamily Conus marmoreus
MMSKLGVLLTICLLLFALTA
VPLDGDQPADRPAERMQDDIS
SERHPMFDAVR
DCCPLPACPFGCNPCC
G
P06224 MrIIIG precursor M superfamily Conus marmoreus
MMSKLGVLLTICLLLFALTA
FPLDGDQPADRPAERMQDDIS
SERHPMFDAVR
DCCPLPACPFGCNPCC
G
P04226 P3.9 precursor M superfamily Conus purpurascens
MMSKLGALLTICLLLFPITA
LLMDGDQPADRPAERMDYDIS
SEVHRLLERR
HPPCCMYGRCRRYPGCSSASCCQG
G
P01407 PIIIA precursor M superfamily Conus purpurascens
MSKLGVLLTICLLLFPITA
LPMDGDQPADRLAERMQDNISS
EEHPFEKR
QRLCCGFPKSCRSRQCKPHRCC
GR
P01406 PIIIE precursor M superfamily Conus purpurascens
MSKLGALLTICLLLFPITA
LLMDGDQPADRPAERMDYDISS
EVHRLLERR
HPPCCMYGRCRRYPGCSSASCCQR
G
P00630 Pn3.1 precursor M superfamily Conus pennaceus
MGVVLFIFLVLFPLATLQ
LDPDQPVERYAENKQLLNPDERR
GIILHALGQR
VCCPPESCTDRCLCCL
G
P00637 Pn3.2 precursor M superfamily Conus pennaceus
MLKMGVLLFTFLVLFPLATLQ
LDADQPVEQYAGNKQDLNPD
EKR
EMILPALRQWQCCTMAWCDSGCLCCE
P00618 PnIVB precursor M superfamily Conus pennaceus
MMSKLGVLLIICLLLCPLTA
VPQDGDQPADQPAERMQDDIS
SEHHPFFDPVKR
CCKYGWTCWLGCSPCGC
P00771 PnIVB precursor M superfamily Conus pennaceus QPADQPAERMQDDISSEHHPFFDPVKR
CCKYGWTCWLGCSP
CGC
P02831 PrIIIE precursor M superfamily Conus parius
MSKLGVLLTICLLLFPITA
LPVDGDQPADRPVERMQDNISS
EQHPFFEKR
AARCCTYHGSCLKEKCRRKYCC
GR
P05553 Pu3.1 precursor M superfamily Conus pulicarius
SKLGVLLTICLLLFPLTA
LPIDGDQPADQPAERMQDDISLE
QNAFFDPVKR
CCPVCISSCSGRCC
P05555 Pu3.2 precursor M superfamily Conus pulicarius
LTIYMLLFLTALPLDG
DQPADQPAERMEDDFITEHHPLFDP
VKW
CCDRPCISSCSGRCC
P05556 Pu3.3 precursor M superfamily Conus pulicarius
MMSKLGVLLTIYMLLFPLTA
LPLDGDQPADQPAERMEDDFI
TEHHPLFDPVKR
CCDRPCSIGCVPCC
P04204 Pu3.4 precursor M superfamily Conus pulicarius
LGVLLPICLLLFPLTA
LPLDGDQPADRPAERMQDDFITEQH
PLFDPVKR
CCDWPCNAGCVPCCF
P04206 Pu3.5 precursor M superfamily Conus pulicarius
LGVLLTICLLLFPLTA
VPLDGDQPADQPAGRMQDDISSEQH
PFFDPVKR
CCVVCNAGCSGNCCP
P04208 Pu3.6 precursor M superfamily Conus pulicarius
VLFPLATLQLDA
DQPVERYAENKQDLNPDERMKFILHALGQ
RR
CCISPACNDSCYCCQ
P04854 Qc3-IP01 precursor M superfamily Conus quercinus
MMSKLGVLLTICLLLFPLTAVQL
DGDQPVDLPALRTQDFAP
EHSPWFNPVKR
CCSRHCWVCIPCCPNGS
P04858 Qc3-IP02 precursor M superfamily Conus quercinus
MMYKLGVLLTTCLLLFPLTAVQL
DGDQPVDLPALRTQDFAP
ERSPWFDPVKR
CCSRDCWVCIPCCPNGS
P04862 Qc3-IP03 precursor M superfamily Conus quercinus
MMYKLGVLLTICLLLFPLTA
VPLDGDQPVDLPALRTQDFAP
ERSPWFDPVKR
CCSRDCLVCIPCCPYGSD
P04807 Qc3-TDG01 precursor M superfamily Conus quercinus
MLKMGVVLFTFLVLFPLAT
LQLDADQPVARYAENKQDFNPN
ERMKIMLSALRQR
ECCEPSWCDAGCTDGCC
P04808 Qc3-YDG01 precursor M superfamily Conus quercinus
MLKMGVVLFVFLVLFPLAT
LQLDADQPVARYAENKQDFNPN
ERMKTMLSALRQR
GCCDPQWCDAGCYDGCC
P04810 Qc3.1 precursor M superfamily Conus quercinus
MLKVGVVLFTFLVLFPLAT
LQLDADQPAARYAENKQDLNPN
ERKEMMLSALRQR
ACCDPDWCDAGCYDGCC
P04818 Qc3.1 precursor M superfamily Conus quercinus
MLKMGVVLFTFLVLFPLAT
LQLDADQPVARYAENKQDLNPN
ERKEMMLSALRQR
ACCDPDWCDAGCYDGCC
P01083 Qc3.1 precursor M superfamily Conus quercinus
MLKMGVVLFTFLVLFPLATLQLDA
DQPAARYAENKQDLNPN
ERKEMMLSALRQR
ACCDPDWCDAGCYDGCC
P01521 RIIIK precursor M superfamily Conus radiatus
MSKLGVLLTICLLLFPLTA
LPMDGDQPVDRLAERMQDNISS
EQHTFFEKR
LPSCCSLNLRLCPVPACKRNPCCT
G
P04725 Rt3-E01 precursor M superfamily Conus rattus
MMLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLNP
DEKR
GILLPALRKFCCDSNWCNISDCECCY
G
P04727 Rt3-E05 precursor M superfamily Conus rattus
MMLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLNP
DEKR
GILLPALRKFCCDSNWCHISDCECCY
G
P04873 Rt3-IP03 precursor M superfamily Conus rattus
MMSKLGVLLTICLLLFPITC
LPLDEDQHADLPALRAQDFEP
EHSPWFDPVRR
CCSQDCSVCIPCCPN
P04886 Rt3-KP01 precursor M superfamily Conus rattus
MMSKLGVLLTICLLLFPHTAVP
LDGDQPADLPAERLQDDIS
SEHHPMFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
P04870 Rt3-KP01 precursor M superfamily Conus rattus
MMSKLGVLLTICLLLFPHTAVP
LDGDQPADQPAERLQDDIS
SEHHPMFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
P04853 Rt3-KP06 precursor M superfamily Conus rattus
MMSKLGALLIICLLLFSLTA
VPLDGDQHADQPAQRLQDRIP
TEDHPLFDPNKR
CCPPVACNMGCKPCC
G
P04829 Rt3-TP02 precursor M superfamily Conus rattus
MSKLRALLIICLLLFPLTA
VPLDGDQPADRPAERMQNDISS
EHHPMFDAIR
GCCGAFACRFGCTPCC
P04881 Rt3-TP04 precursor M superfamily Conus rattus
MMSKLGVLLITCLLLFPLTA
VPLDGDQPADRPAERLQDDIS
SENHPFFDPVKR
CCNAGFCRFGCTPCCY
P04844 Rt3-WP01 precursor M superfamily Conus rattus
MMSKLGALLTICLLLFSLTA
VPLDGDQHADQPAQRLQDRIP
TEDHPLFDPNKR
CCDDSECSYSCWPCCY
G
P04776 S14-H01 precursor M superfamily Conus striatus (Striated cone)
MLKMGVVLFTFQVLFPLAT
LQLDADQPVERHAENKQDLIPD
ERRGILLHALKQR
VWCDWEWCYGDCHCFD
P04719 S3-D01 precursor M superfamily Conus striatus (Striated cone)
MLKLGMVLFIFLVLLPLATLHLDA
DQPVERNANKQGLKPDE
RRRFRFSAPRKR
ECCELEWCDGACDCCD
P04787 S3-E02 precursor M superfamily Conus striatus (Striated cone)
MLKMGVVLFTFLVLFPLAT
LQLDADQPVERYVENKQDLNPD
ERSNFRLPLVRR
CCSVSICQPPPVCECCA
P04756 S3-E02 precursor M superfamily Conus striatus (Striated cone)
MLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLNPD
EKR
GILLPALRKFCCDSNWCNISDCECCY
G
P04788 S3-E03 precursor M superfamily Conus striatus (Striated cone)
MLKMGVVLFTFLVLFPLAT
LQLDADQPVERYVENKQDLNPD
ERSNFRLPLVRR
CCSVSICQSPPVCECCA
P04893 S3-G04 precursor M superfamily Conus striatus (Striated cone)
MSKLGVLLSICLLLFPLTA
LPMDEDQPADQLEDRMQDDISS
EQYPSFVRR
QKCCGEGSSCPKYFKNNFICGCC
P04724 S3-I01 precursor M superfamily Conus striatus (Striated cone)
MLKMGVMLFTFLVLFPLATLQLDA
DQPVERYAEDKQDLNRD
ERMGFILHALGQR
QCCDWPWCDDCICCD
P04757 S3-I01 precursor M superfamily Conus striatus (Striated cone)
MLKLGMVLFIFLVLFPLATLHLDA
DQPVERYAEDKQDLNRD
ERMGFILHALGQR
QCCDWPWCDDCICCD
P04706 S3-I05 precursor M superfamily Conus striatus (Striated cone)
MFKMGVVLFTYLVLFPLATFQLDA
DQPVERYAENKQDLNPD
ERMKFKLHNLGQR
RCCISPACHDDCICCIT
R
P04895 S3-KP02 precursor M superfamily Conus striatus (Striated cone)
MMSKLGVLLTICLLLFPHTAVP
LDGDQHADRPAERMQDDIS
SEHHPMFDAVKRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
P04890 S3-KP02 precursor M superfamily Conus striatus (Striated cone)
MMSKLGVLLTICLLLFPHTAVP
LDGDQHADQPAERLQDDIS
SENNPMFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
P04887 S3-KP02 precursor M superfamily Conus striatus (Striated cone)
MMSKLGVLLTICLLLFPHTAVP
LDGDQPAERLQDDISSEHH
PMFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACLAGCK
PCC
G
P04748 S3-L02 precursor M superfamily Conus striatus (Striated cone)
MLKMGVMLFIFLVLFPLATLHLDA
DQPVERYAENKQLLNTD
ERREIILSALRR
QCCDSNSCEYPKCLCCN
G
P04774 S3-S01 precursor M superfamily Conus striatus (Striated cone)
MLKMRVVLFTFLVLFPLATLQLDA
DQPVERNAENKQDLIPD
KRRVILLRALRQWR
CCPKEWCNRDCSCCT
P04795 S3-S02 precursor M superfamily Conus striatus (Striated cone)
MLKMRVLLFTFLVLFPLVTL
QLDADQPVERYAENKQDLNPD
ERREITLHALGKR
CCPARMCMAACSCCD
P04867 S3-TS01 precursor M superfamily Conus striatus (Striated cone)
MMSKLGVLLTICLLLFPLT
AVPLDGDQPLDRHAERMHDGIS
PKRHPWFDPVKR
CCKVQCESCTSCC
P04904 S3-VP01 precursor M superfamily Conus striatus (Striated cone)
MMSKLGVLLTICMLLFPLAA
FPLDGDQPADQPAERMQYDRL
RAMNPWFDPIKR
CRCEQTCGTCVPCC
P04871 S3-WP01 precursor M superfamily Conus striatus (Striated cone)
MMSKLGALLTICLLLFSLTA
VPLDGDQHADQPAQRLQDRIP
TEDHPLFDLNKR
CCDDSECSYSCWPCCY
G
P04698 S3-Y01 precursor M superfamily Conus striatus (Striated cone)
MLKMGVVLFTFLVLFPLAT
LQLDADQPVERYAENKQDLNPN
ERMKMIMSALGQR
RCCISPACHEECYCCQ
P04905 SIIIA precursor M superfamily Conus striatus (Striated cone)
MMSKLGVLLTVCLLLFPLTA
VPMDGDQPADRPAERMQDDIS
SDEHPLFDKR
QNCCNGGCSSKWCRDHARCC
GR
P00825 SIIIA precursor M superfamily Conus striatus (Striated cone)
MMSKLGVLLTVCPLLFPLTA
LPPDGDQPADRPAERMQDDIS
SDEHPLFDKR
QNCCNGGCSSKWCRDHARCC
GR
P01629 SmIIIA precursor M superfamily Conus stercusmuscarum PLFDKR
QRCCNGRRGCSSRWCRDHSRCC
GRR
P05227 T3.1 precursor M superfamily Conus tulipa (tulip cone)
MSKLGVLLTICLLLFPLTA
LPMDGDEPADRPAERMQDNISS
EQHPLFEER
HGCCKGPEGCSSRECRPQHCC
GRR
P04755 Tr3-E02 precursor M superfamily Conus terebra
MLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLNPD
EKR
GILLPALRKFCCDSNWCNISDCECCY
G
P04906 Ts3-IP07 precursor M superfamily Conus tessulatus
MMSKLGALLTICLLLFPLTAVQL
DGDQPADLPELRAQDFAP
ERSPWFDPVRR
CCSQDCSVCIPCCPN
P04824 Ts3-IP07 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLTAVQL
DGDQPADLPELRAQDFAP
ERSPWFDPVRR
CCSQDCSVCIPCCPN
P04851 Ts3-IP07 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLTAVQL
DGDQPADLPALRAQDFAP
ERSPWFDPVRR
CCSQDCSVCIPCCPN
P04868 Ts3-IP10 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLTA
GQLDGDQPADLPALRAQDFAP
ERSPWFDPVRR
CCSQDCSVCIPCCP
P04875 Ts3-SGN01 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLT
AVPLDGDQPADQPAERMQDDIS
SEQHPFFDPVKR
CCVVCNAGCSGNCCS
P04709 Ts3-Y01 precursor M superfamily Conus tessulatus
MLKMGVVLFTFLVLFPLAT
LQLDADQPVERYAENKQGLNPD
ERMKFILHALGQR
RCCISPACNDTCYCCQD
R
P04899 Ts3.1 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLTAV
SLDGDQPADLPALRAQDFAP
ERSPWFDPVRR
CCSQDCRVCIPCCPN
P00621 Ts3.1 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLTAVQL
DGDQPADLPELRAQDFAP
ERSPWFDPVRR
CCSQDCRVCIPCCPN
P00626 Ts3.2 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLTAVS
LDGDQPADLPELRAQDFAP
ERSPWFDPVRR
CCSQDCRVCIPCCPY
P00623 Ts3.2 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLTAVQL
DGDQPADLPELRAQDFAP
ERSPWFDPVRR
CCSQDCRVCIPCCPY
P00628 Ts3.3 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLTAVQL
DGDQPADLPALRTQDIAT
DHSPWFDPVKR
CCSRYCYICIPCCPN
P00625 Ts3.3 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLTAVQL
DGDQPADLPALRTQDIST
DHSPWFDPVKR
CCSRYCYICIPCCPN
P00627 Ts3.4 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLTVLP
MDGDQPADLPALRTQDIAT
DQSPWFDPVKR
CCSRYCWKCIPCCPY
P00632 Ts3.5 precursor M superfamily Conus tessulatus
MLKMGVVLFVFLVLFPLATLQ
LDADQPVERYAENKQLVSPY
ERRQIILHALGQR
DCCVMPWCDGACDCCVSS
P04815 Ts3.6 precursor M superfamily Conus tessulatus
MLKMGVVLFVFLVLFPLAT
LQLDADQPVERYAENKQLVSPY
ERKEIILHALGQR
QCCDWQWCDGACDCCA
P00633 Ts3.6 precursor M superfamily Conus tessulatus
MLKMGVVLFVFLVLFPLATLQ
LDADQPVERYAENKQLVSPY
ERRQIILHALGQR
QCCDWQWCDGACDCCA
P00638 Ts3.7 precursor M superfamily Conus tessulatus
MLKMGVVLFTFLVLFPLATLQ
LDADQPVERYAENKQGLNPD
ESREIILSALRQR
DCCEQGWCDGGCDCCQ
P00611 TsMMSK-021 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLTA
VPLDGDQHADRPADRMQDISS
EQHPLFDPVKR
CCDWPCTIGCVPCCLP
P00610 TsMMSK-021 precursor M superfamily Conus tessulatus
MMSKLGVLLTICLLLFPLTAVRL
DGDQHTDRPADRMQDIAT
EQHPLFDPVKR
CCDWPCTIGCVPCCLP
P04786 Tx3-E05 precursor M superfamily Conus textile (Cloth-of-gold cone)
MLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLSPD
ERR
GILLPALRKFCCDSNWCNISDCECCY
G
P04754 Tx3-E09 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLNP
DEKRGILLPALRK
FCCDSNWCNISDCECCY
G
P04729 Tx3-E09 precursor M superfamily Conus textile (Cloth-of-gold cone)
MLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLNPD
EKRGILLPALRK
FCCDSNWCNISDCECCY
G
P04728 Tx3-E09 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLNP
DEKRGILLPALRR
FCCDSNWCNISDCECCY
G
P04903 Tx3-KP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGVLLTICLLLFPHTAVP
LDGDQHADRPAERMQDDIS
SEHHPMFDAVKRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
P04855 Tx3-KP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGVLLTICLLLFPHTAVP
LDGDQHADRPAERLQDDIS
SEHPMFDAVRRREQNQFKSFTSVKLLDSRGER
CCGPTACLA
GCKPCC
G
P04892 Tx3-KP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGVLLTICLLLFPHTAVP
LDGDQHADQPAERLQDDIS
FENNPMFNSIRRRVQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
P06139 Tx3-KP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGVLLTICLLLFPHTA
VPLDGDQPADQPAERLQDDIS
SEHHPMFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
P04885 Tx3-KP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGVLLTICLLLFPHTAVP
LDGDQPADRYAERMQDDIS
SEHPMFDAVRGREQNQFKSFTSVKLLDSRGER
CCGPTACLA
GCKPCC
G
P04877 Tx3-KP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGALLTICLLLFSLTA
VPLDGDQPADQPAERLQDDIS
SEHHPMFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
P04839 Tx3-KP03 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGVLLTICLLLFPHTAVP
LDGDQPAERLQDDISSEHH
PMFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACLAGCK
PCCY
P04743 Tx3-L02 precursor M superfamily Conus textile (Cloth-of-gold cone)
MLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLSPD
ERREIILSALRR
QCCDSNSCEYPKCLCCN
G
P04744 Tx3-L03 precursor M superfamily Conus textile (Cloth-of-gold cone)
MLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLSPD
ERREIILSALRR
QCCDRNSCEYPKCLCCN
G
P04910 Tx3-SR01 precursor M superfamily Conus textile (Cloth-of-gold cone)
MSKLGALLIICLLLFPLTA
VPLDGDQPADRPAERMQDDISS
EHHPMFDAIR
GCCHPSTCHVRKGCSRCCP
P04834 Tx3-TP01 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGALLTICLLLFPLTA
VPMDGDQPADRPAERMQDDIS
FEQHPMFDAVR
GCCHLLACRMGCTPCCW
P04897 Tx3-TP08 precursor M superfamily Conus textile (Cloth-of-gold cone) M
MFKLGVLLTICLLLFSLNA
VPLDGDQPADQPAER
LPDDIS
SENNPFYDPVKWCCMTCFGCTPCCGSPASSSV
P04888 Tx3-TP11 precursor M superfamily Conus textile (Cloth-of-gold cone) M
MFKLGVLLTICLLLFSLNA
VPLDGDQPADQPAERLPDDIS
SENNPFYDPVKR
CCMTCFGCTPCC
G
P04850 Tx3-WP04 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGALLTICLLLFPLTA
VPMDGDQPADQPAQRLQDRLP
TEDHPLYDPVKR
CCDDSECDYSCWPCCIFS
P01467 Tx3f precursor M superfamily Conus textile (Cloth-of-gold cone)
MSKLGVLLTICLLLFPLTA
LPLDGDQPADQAAERMQAEQHP
LFDQKR
RCCKFPCPDSCRYLCC
G
P01472 Tx3h precursor M superfamily Conus textile (Cloth-of-gold cone)
MLKMGVVLFIFLVLFPLATLQLDA
DQPVERYAENKQLLNPD
ERREILLPALR
KFCCDSNWCHISDCECCY
G
P00629 Tx3h precursor M superfamily Conus textile (Cloth-of-gold cone)
MMLKMGVVLFIFLVLFPLATLQLDA
DQPVERYAENKQLLNP
DERRGILLPALR
KFCCDSNWCHISDCECCY
G
P00640 TxIIIA precursor M superfamily Conus textile (Cloth-of-gold cone)
MLKMGVVLFIFLVLFPLATLQLDA
DQPVERYAENKQLLSPD
ERREIILHALGTR
CCSWDVCDHPSCTCCG
P01401 TxIIIB precursor M superfamily Conus textile (Cloth-of-gold cone)
MSKLGALLTICLLLFSLTA
VPLDGDQHADQPAQRLQDRIPT
EDHPLFDPNKR
CCPPVACNMGCKPCC
G
P01396 TxIIIC precursor M superfamily Conus textile (Cloth-of-gold cone)
MMFKLGVLLTICLLLFSLN
AVPLDGDQPADQPAERLLDDIS
FENNPFYDPAK
RCCRTCFGCTPC
CG
P04860 TxIIIC precursor M superfamily Conus textile (Cloth-of-gold cone)
MMFKLGVFLTICLLLFSLNA
VPLDGDQPADQPAERLLDDIS
FENNPFYDPAKR
CCRTCFGCTPCC
G
P04742 TxMLKM-021 precursor M superfamily Conus textile (Cloth-of-gold cone)
MLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLNPD
EKRGILLPALRTR
VCCPFGGCHELCQCCE
G
P04741 TxMLKM-021 precursor M superfamily Conus textile (Cloth-of-gold cone)
MLKMGVMLFIFLVLFPLATLQLDA
DQPVERYAENKQLLSPD
ERREIILSALRTR
VCCPFGGCHELCQCCE
G
P00631 TxMLKM-021 precursor M superfamily Conus textile (Cloth-of-gold cone)
MLKMGVVLFIFLVLFPLATLQ
LDADQPVERYAENKQLLNTD
ERREIILSALRTR
VCCPFGGCHELCQCCE
G
P00620 TxMMSK-01 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGVLLITCLLLFPLTA
VPLDGDQPADQPAERLQDDIS
SENHPFFDPVKR
CCRLLCLSCNPCC
G
P04896 TxMMSK-02 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGALLTICLLLFSLTTVP
LDGDQHADQPAQRLQDRIP
TEDHPLFDPNKR
CCDDSECSYSCWPCCY
G
P00614 TxMMSK-02 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGALLTICLLLFSLTA
VPLDGDQHADQPAQRLQDRIP
TEDHPLFDPNKR
CCDDSECSYSCWPCCY
G
P00613 TxMMSK-03 precursor M superfamily Conus textile (Cloth-of-gold cone)
MSKLGALLIICLLLFPLTA
VPMDGDQPADRPAERMQDDISF
EQHPMFDATRR
CCNAGFCRFGCTPCCY
P00615 TxMMSK-04 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGVLLTICLLLFPLTA
VPLDGDQPADRPAERMQDGIS
SEHHPFFDSVKKK
QQCCPPVACNMGCEPCC
G
P00617 TxMMSK-05 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGALLIICLLLFPLTA
VPLDGDQHADRPAERLQDDIS
SKHHPMFDAVR
GCCHPSTCHMRKGCSRCCS
P00616 TxMMSK-06 precursor M superfamily Conus textile (Cloth-of-gold cone)
MMSKLGVLLTICLLLFPHTAVP
LDGDQHADQPAERLQDDIS
SEHHPMLNSIRRREQNQFMSFTSVKLRDSRGER
CCGPTACM
AGCRPCC
G
P06365 Vc3 precursor M superfamily Conus victoriae
MSKLGVVLFTFLLVFSLA
TPMPIQDQPAGRNAEPRGKIRDG
MIR
HPHNHFPFACPWC
G
P06364 Vc3.1 precursor M superfamily Conus victoriae
MLKMGVVLFIFLVLFPLATL
QLDADQPVERYAENKQLLNPD
ERREIILHALGTR
CCSWDVCDHPSCTCCG
G
P06355 Vc3.10 precursor M superfamily Conus victoriae
MMFKLGVLLTICLLLFSLNA
VPLDGDQHADQPAERREDDIS
FENNPFFDPVKR
CCMTCFGCTPCC
G
P06363 Vc3.2 precursor M superfamily Conus victoriae
MLKMGMVLFIFLLLFPLATL
QLDADQPVERYAENKQLLNPD
ERRGILLPALKQR
VCCPFGDCHEICYCCG
G
P06362 Vc3.3 precursor M superfamily Conus victoriae
MLKMGVVLFTFLVLFPLATL
QLNADRPVERYAANKQDLNPD
ETREMILHVLGQR
LCCWSEMCHARCKCC
G
P06361 Vc3.4 precursor M superfamily Conus victoriae
MLKMGVLLFTFLVLFPLATLQLDA
DRPVERYAANKQDLNPE
ERR
KFILHALGQWQCCTMQWCDKACYCCE
P06360 Vc3.5 precursor M superfamily Conus victoriae
MMSKLGVLLIICLLLFPLTA
VPLDGDQPADRYAERMQDDIS
SEHHPMFDAVR
GCCGPTACIVGCKPCC
G
P06359 Vc3.6 precursor M superfamily Conus victoriae
MMSKLGALLIICLLLFSLTA
VPLDGDQPADQPAERMQDNIS
SKHHPMFDAVR
GCCHPSTCHMRKGCSRCCS
P06358 Vc3.7 precursor M superfamily Conus victoriae
MMSKLGVLLIICLLLFPLTA
IPQDGDQPADRPAERMQDDIS
FEHHPMFDATR
GCCNAGFCRFGCTPCCW
P06357 Vc3.8 precursor M superfamily Conus victoriae
MMSKLGVLLTICLLLFPLTA
LPMDGDQPAYRPAERR
QHVSS
EQHPLFDAVKGCCTHPCTLGCTPCCY
P06356 Vc3.9 precursor M superfamily Conus victoriae
MMSKLGALLTICLLLFSLTA
VPLDGDQHADQPAERLHDRLP
TENHPLYDPVKR
CCDDSECDYNCWPCCIF
G
P05908 Vi001 precursor M superfamily Conus virgo
MSKLGVVLFIFLVLFPMATL
QLDGDQPADRRADEKDLTQQY
LNLRRVLQR
GLVCAHVSPSQNSWWT
P00619 Vn3.1 precursor M superfamily Conus ventricosus
MMSKLGALLTICLLLFPLTA
LPLDGDQPADRPAERMQDDIS
SEQHPLFDKER
QCCTGSCLNCWPCC
G
P00622 Vn3.2 precursor M superfamily Conus ventricosus
MMSKLGVLLTICLLLFPLTA
VPMDGDQPADLPALRTQDFEP
ERSPWFDPVRR
CCSQDCSVCIPCCPPP
P00624 Vn3.3 precursor M superfamily Conus ventricosus
MMSKLGVVLTICLLPFPLTA
LPMDGDQPADLPALRTQDFEP
ERSPWFDPVKR
CCSQDCRVCIPCCPY
P00634 Vn3.4 precursor M superfamily Conus ventricosus
MLKMGVMLFIFLVLFPLATLQ
LDADQPVERYAENKRLMSPD
ERRAILHAPRQR
GCCEPDWCDSGCDDGCC
P00635 Vn3.5 precursor M superfamily Conus ventricosus
MLKMGVVLFIFLVLFTLATLQL
DADQPVERYAENKRLMSPY
KR
RAILHAPREQECCEPQWCDGGCDACC
P00636 Vn3.6 precursor M superfamily Conus ventricosus
MLKMGVVLFIFLVLFTLATLQL
DADQPVERYAENKQLLSPD
ERRDIILHALGQRR
CCDPDWCDAGCYDGCC
P04863 Vr3-3-VP01 precursor M superfamily Conus varius
MMSKLGVLLTICMLLFPLAVFP
LDGDQPADQPAERMQYDML
RAMNPWFDPIKR
CRCEQTCGTCVPCC
P05113 Vr3-D01 precursor M superfamily Conus varius
MLKLGMVLFIFLVLFPLATLHLDA
DQPVERNVNKQGLKPNE
RRFRFSAPRKR
ECCEWEWCDGACDCCN
P04857 Vr3-IP01 precursor M superfamily Conus varius
MMSKLGVLLTICLLLFPITG
LPLDEDQHADLPALRAQAFEP
EHSPWFDPVRR
CCSQDCWECIPCCPN
P04825 Vr3-IP03 precursor M superfamily Conus varius
MMSKLGVLLTICLLLFSLTAVQL
DGDQPVDLPALRTQDFAP
EHSPWFNPVKR
CCSRRCWVCIPCCPNGS
P04859 Vr3-IP08 precursor M superfamily Conus varius
MMSKLGVLLTICLLLFPLTAVQL
DGDQPADLPELRAQDFAP
ERSPWFDPVRR
CCSQDCSVCIPCCPN
P04745 Vr3-L01 precursor M superfamily Conus varius
MLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLNTD
ERREIILSALRR
QCCDSNSCEYPKCLCCN
G
P04796 Vr3-NPP01 precursor M superfamily Conus varius
MLKMGVVLFTFLVLFPLAT
LQLDADQPVERYAENKQDINPD
ER
KAFITLALGQEGCCPSGPCHFAACNPPCCT
P04740 Vr3-Q01 precursor M superfamily Conus varius
MLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLNTD
ERREIILSALRTR
VCCPFGGCHELCQCCE
G
P04797 Vr3-SP01 precursor M superfamily Conus varius
MLKMGVVPFTFLVLFPLATLQLDA
DQPVERNAENKQDINPD
ERRGFITLALRHR
GCCPIGPCMQSVCSPCCP
P04798 Vr3-SP01 precursor M superfamily Conus varius
MLKMGVVLFTFLVLFPLAT
LQLDADQPVERNAENKQDINPD
ERRGFITLALRHR
GCCPIGPCMQSVCSPCCP
P04799 Vr3-SP02 precursor M superfamily Conus varius
MLKMGVVLFTFLVLFPLAT
LQLDADQPVERNAENKQDINPD
ERRGFITLALRHR
GCCPIGPCLQSVCSPCCP
P04827 Vr3-SP04 precursor M superfamily Conus varius
MSKLGALFVICLLLFPLTA
VPLDGDQPADQPAQRMQDDISS
EHPLFDAVR
GCCHLLACRMGCSPCCW
P04751 Vr3-T05 precursor M superfamily Conus varius
MLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLSPD
ERR
EIILHALGTRCCSWDVCDHPSCTCC
G
P04865 Vr3-TYN01 precursor M superfamily Conus varius
MMSKLGVLLTICLLLFPITG
LPLDEDQPADLPALRMEDFAP
EHSPLFDPVKR
CCILCWKCTYNCCRAW
P04840 Vr3-VP08 precursor M superfamily Conus varius
MMSKLGALLTICLLLFSLTA
VPLDGDQHADQPAQRLQDRIP
TEDHPVRR
CCDLPCNAGCVPCC
P04900 Vr3-VP08 precursor M superfamily Conus varius
MMAKLGVLLTICLVLFPLTA
LPLDGDQLADRPAERMQDDNS
PERSHWFDPVRR
CCDLPCNAGCVPCC
P04907 Vr3-WP04 precursor M superfamily Conus varius
MMSKLGALLAICLLLFSLTA
VPLDGDQHADQPAQRLQDRIP
TEDHPLFDPNKR
CCDDSECSYSCWPCCY
G
P04869 Vr3-WP04 precursor M superfamily Conus varius
MSKLGALLTICLLLFSLTA
VPLDGDQHADQPAQRLQDRIPT
EDHPLFDPNKR
CCDDSECSYSCWPCCY
G
P04707 Vr3-Y02 precursor M superfamily Conus varius
MLKMGVVLFTFLVLFPLAT
LQLDADQPVERYAENKQGLNPD
ERMKFILHALGQR
RCCISPACNDTCYCCQD
R
P04718 VrD01 precursor M superfamily Conus varius
MLKLGMVLFIFLVLLPLATLHLDA
DQPVERNVNKQGLKPDE
RRRFRFSAPRKR
ECCELEWCDGACDCCD
P04721 Vt3-D02 precursor M superfamily Conus vitulinus
MLKLGMVLFIFLVLFPLATLHLDA
DQPVERNVNKQGLKPNE
RRFRFSAPRKR
ECCEWEWCDGACDCCN
P04726 Vt3-E03 precursor M superfamily Conus vitulinus
MLKMGVMLFIFLVLFPLATLQLDA
DQPVERYAENKQLLNPD
EKR
GILLPALRKFCCDSNWCNISDCECCY
G
P04894 Vt3-EP01 precursor M superfamily Conus vitulinus
MMSKLGVLLTICLLLFPLT
AVPLDGDQPADRPAERMQDGIS
SEHHPFFDSVKKK
QQCCPPVACNMGCEPCC
G
P04826 Vt3-KP04 precursor M superfamily Conus vitulinus
MMSKLGVLLTICLLLFPHTAVP
LDGDQPADQPAERLQDDVS
SEHHPMFNSIRRREQNQFKSFTSVKLLDSRGER
CCGPTACL
AGCKPCC
G
P04902 Vt3-KP04 precursor M superfamily Conus vitulinus
MMSKLGALLTICLLLFSLTA
VPLDGDQHADQPAERLQDDIS
SEHPMFDAVRRREQNQFKSFTSVKLLDSRGER
CCGPTACLA
GCKPCC
G
P04746 Vt3-L01 precursor M superfamily Conus vitulinus
MLKMGVMLFIFLVLFPLATLQLDA
DQPVERYAENKQLLNTD
ERREIILSALRR
QCCDSNSCEYPKCLCCN
G
P04898 Vt3-SP01 precursor M superfamily Conus vitulinus
MMSKLGVLLIICLLLFSLNA
VPLDGDQPADRYAERMQDDIS
SEHPLFDAVR
GCCHLLACRMGCSPCCW
P04912 Vt3-SR01 precursor M superfamily Conus vitulinus
MSKLGALLIICLLLFPLTA
VPLDGDQPADRPAERMQDDISS
EHHPMFDAIR
GCCHPSTCHVRKGCSRCCS
P04752 Vt3-T01 precursor M superfamily Conus vitulinus
MLKMGVMLFIFLVLFPLATLQLDA
DQPVERYAENKQLLSPD
ERREIILHALGTR
CCSWDVCDHPSCTCC
G
P04828 Vt3-TP01 precursor M superfamily Conus vitulinus
MSKLGALLIICLLLFPLTA
VPMDGDQPADQPAERMQDDISF
EQHPMFDATR
SCCNAGFCRFGCTPCCY
P04849 Vt3-TP09 precursor M superfamily Conus vitulinus M
MFKLGVLLTICLLLFSLNA
VPLDGDQPADQPAERLPDDIS
SENNPFYDPVKR
CCMTCFGCTPCC
G
P04708 Vt3-Y01 precursor M superfamily Conus vitulinus
MMLKMGVVLFTFLVLFPLAT
LQLDADQPVERYAENKQGLNP
DERMKFILHALGQR
RCCISPACNDTCYCCQD
R
P04219 Vt3.1 precursor M superfamily Conus vitulinus
MLKMGVVLFIFLVLFPLATLQLNA
DQPVERNAENIQDLNPD
KRVIKIPVP
RRR
GPYRRYGNCYCPI
G
P04060 Vt3.2 precursor M superfamily Conus vitulinus
LLFPLATLQLNA
DQPVERNAENIQDLNPDKRFIFMPVPRRR
GPYGSVHRRR
GPYRRHGNCFCPS
G
P04565 Vt3.3 precursor M superfamily Conus vitulinus
MMSKLGVLLTICLLLFPLTALP
MDGDQPADQPAERLQDISP
KETPGSDPFKR
CCHWPYCAPPPLGCRCC
GK
P04693 Vx3-2-R01 precursor M superfamily Conus vexillum
MMLKMGVVLFVFLVLFPLAT
LQLDADQPVERYAENKQDNPD
ERKGFVSLALR
RPCCSLRWCSNYCRCGI
P04753 Vx3-A01 precursor M superfamily Conus vexillum
MLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLSPD
ERREIILHALGTR
CCSWDVCDRPSCACC
G
P04762 Vx3-D03 precursor M superfamily Conus vexillum
MLKMGVVLFVFLVLFPMATLQLDA
DQPVERYAENKQDLNAD
ERMGLILPALRQR
TCCVRPWCDGACDCCVDP
P04764 Vx3-D03 precursor M superfamily Conus vexillum
MLKMGVVLFVFLVLFPLAT
LQLDADQPVERYAENKQDLNAD
ERMGYILPALSQQ
TCCVRPWCDGACDCCVDS
P04759 Vx3-D03 precursor M superfamily Conus vexillum
MLKMGVVLFVFLVLFPMATLQLDA
DQPVERYAENKQDHNAD
ERMGYILPALRQR
TCCVRPWCDGACDCCVDP
P04768 Vx3-F01 precursor M superfamily Conus vexillum
MLKMGVVLFTFLVLFPLAT
LQLDADQHVERNAENKQDLIPD
KRRVILLRALRQR
RCCPMEWCDGDCFCCV
P04767 Vx3-G02 precursor M superfamily Conus vexillum
MLKMGVVLFVFLVLFPLATFQLDA
DQPVKRYAKYKQDLNTD
KRMRLILPALRQR
QCCGWEWCDDICGCCE
P04880 Vx3-HYQ01 precursor M superfamily Conus vexillum
MMSKLGCLLTICLVLFPLTA
LPLDGDQPAERPAKRTQDDIP
NGQDPLIDR
QINCCPWPCPDSCHYQCCH
P04701 Vx3-I03 precursor M superfamily Conus vexillum
MFKMGVVLFTYLVLFPLATFQLDA
DQPVERYVENIQDLNPD
ERMEFILHALGQR
RCCVHPACHDDCICCIT
R
P04704 Vx3-I04 precursor M superfamily Conus vexillum
MFKMGVVLFTYLVLFPLATFQLDA
DQPVERYAENKQDLNPD
ERMKFKLHNLGQR
RCCISPACHDECICCID
R
P04747 Vx3-L03 precursor M superfamily Conus vexillum
MLKMGVMLFIFLVLFPLATLHLDA
DQPVERYAENKQLLNTD
ERREVILSALRR
QCCDRNSCEYPKCLCCN
G
P04739 Vx3-Q01 precursor M superfamily Conus vexillum
MMLKMGVVLFIFLVLFPLAT
LQLDADQPVERYAENKQLLNT
DERREIILSALRTR
VCCPFGGCHELCQCCE
G
P04688 Vx3-R01 precursor M superfamily Conus vexillum
MMLKMGVVLFVFLVLFPPATLQ
LDADQPVERYVGNKQDLNP
DERRGFISPALRRR
RCCTWQECDGNCRCCQ
R
P04913 Vx3-VV01 precursor M superfamily Conus vexillum
MMSKLGVLLTICLVLFPLTA
LPLDGDQPANRPAERAQDDTS
AAQNPWFDHVKR
CCTVCTTGCVVCC
P04876 Vx3-VV01 precursor M superfamily Conus vexillum
MMSKLGVLLTICLVLFPLTA
LPLDGDQPADRHAERMQDDTS
AAQNPWFDHVKR
CCTVCTTGCVVCC
P04738 Vx3-Y01 precursor M superfamily Conus vexillum
MMLKMGVVLFICLVLFPLAT
LQLDADQPVERLLENKQDLNP
EKRSDFKMRAWRAR
GCCDYDWCDEFCYCCE
P00823 VxII precursor M superfamily Conus vexillum
MMSKLGVLVTICLLLFPLTA
LPLDGDQPADHPAKRTQDHNL
ASPISA
WIDPSHYCCCGGGCTDDCVNC