Protein List

Your search: Gene superfamily in [O3 superfamily] and Protein Type in [Precursor]

Found 43 entries.


ID Name Gene superfamily Organism Sequence
P00753 Ar6.20 precursor O3 superfamily Conus arenatus
MSRLGIMVLTLLLLVYMATS
HQDAGEKQATQRDAINFRWKR
SLTRR
TATEECEESCEEEEKTCCGE.DGEPVCARFCL
G
P00754 Ar6.21 precursor O3 superfamily Conus arenatus
MSRLGIMVLTLLLLVFIVTS
HQDAGEKQATQRNAINFRWRR
SFTRR
AATEECEEYCEDEEKTCCGLEDGEPVCATTCL
G
P00755 Ar6.22 precursor O3 superfamily Conus arenatus
MSRLGIMVLTLLLLVFIVTS
HQDAGEKQATKRAAVNFRWRR
SFTRR
AAAEECEEYCEEEEKTCCGEEDGEPVCAEFCL
G
P00756 Ar6.24 precursor O3 superfamily Conus arenatus
MSRLGIMVLTLLLLVFIVTS
HQDAGEKQATHRGAINFRWRR
SLIRR
TATEECEEYCEDEEKTCCGLEDGEPVCATTCL
G
P00758 Ar6.24 precursor O3 superfamily Conus arenatus
MSRLGIMVLTLLLLVFIVTS
HQDAGEKQATQRAAINFRWKR
SLTRR
TATEECEEYCEDEEKTCCGEEDGEPVCARFCL
G
P00759 Ar6.25 precursor O3 superfamily Conus arenatus
MSGLGIMVLTLLLLVFMETSHQ
DAGEKQAMQRDAINVRRRR
SITRR
VSEACEESCEEEEKHCCHENNGVYTCLRYCW
G
P00760 Ar6.26 precursor O3 superfamily Conus arenatus
MSGLGIMLLTLLLLVFMETSHQ
DAGEKQATQRDAINVRRRR
SLTRR
VTEECEENCEEEEKHCCNTNNGPSCAPQCF
G
P00757 Ar6.27 precursor O3 superfamily Conus arenatus
MSGLGILVLTLLLLVYMATS
HQDAGEKQATQRDAINVRRRR
SLTRR
VAEECEESCEDEEKHCCNTNNGPSCAPQCF
G
P04227 Bromosleeper peptide precursor O3 superfamily Conus radiatus
MSGLGFMVLTLLLLTFMATSHQ
DRGEKQATQRHAINVIRRR
LITR
WATIDECEETCNVTFKTCCGPPGDWQCVEACPV
P02723 CaFr179 precursor O3 superfamily Conus caracteristicus
MSGLGIMVLTLLLLVFMEA
SHQDAGEKQATQRDAINVRRRR
SLARR
TVTEECEEDCEDEEKHCCNTNNGPSCARLCF
G
P05921 Di6.11 precursor O3 superfamily Conus distans
MSGLGFMVVTLLLLVPMATS
QQDGGEKQAMQR
DAINVAPGT
SITRTETDQECIDTCKQEDKKCCGRSNGVPTCAKICL
G
P05922 Di6.12 precursor O3 superfamily Conus distans
MSGLGFMVLTFLLLVSMATS
KQDGRVRRRMLHTR
LVEGACT
SPSNCPTGQECCPDKLDEPEGSCANSCPFY
P05939 Di6.6 precursor O3 superfamily Conus distans
MSGLGFMVLTLLLLVPMATS
QQDGGEKQAMQR
DAINVAPGT
SITRTETDQECIDICKQEDKKCCGRSNGEPTCAKICL
G
P05940 Di6.7 precursor O3 superfamily Conus distans
MSGLGFMVLTLLLFVPMATS
QQDGGEKQAMQR
DAINVAPGT
SIIGTETNQECIDICKQEDKNCCGKSNGVPTCGKICL
G
P04572 Eu6.6 precursor O3 superfamily Conus eburneus
MSGLGIMVLTLLLLVFMATSHQ
HRGGKQLMLRNNLQKR
TCS
SPSNCPTGQECCPDKVDEPEGFCADECIIT
P05747 G27 precursor O3 superfamily Conus geographus (Geography cone)
MSGLGIMVLTLLLLVSMAIS
HRYAREKQATRRDVVNIRRR
S
KPKTPECKRICKLEEKKCCCVRSEGPKCSRLCGLPMFC
P05735 G6.6 precursor O3 superfamily Conus geographus (Geography cone)
MSGLRIMVLTLLLLVLMTTSHQ
DAGEKQAMQRDAKNFSRRR
LGIRKPKTR
ECEMLCEQEEKHCCRIRNENIQCAPRCLGIGV
P02722 LiCr173 precursor O3 superfamily Conus lividus
MSGLGTMVLTLLLLVFMVTSHQDGG
KKQATQRNAVNIRRRK
SITQR
TTDEKCNEYCEERDRNCCGKANGEPRCARMCF
G
P06323 O3_Vc1 precursor O3 superfamily Conus victoriae
MSGLGIMLLALLLLVSLETSLQG
GGEGQAMHRDKNQQGRRR
ILLRRALQKSRKPPQGTKKSASLDFQVPVVLA
P00761 Pn6.10 precursor O3 superfamily Conus pennaceus
MSGLGIMVLTLLLLVFMETSHQ
DAGEKQAMQRDAINVRRRR
SITRR
VSEACEESCEDEEKHCCHENNGVYTCLRYCW
G
P00762 Pn6.11 precursor O3 superfamily Conus pennaceus
MSRLGIMVLTLLLLVFIVTS
HQDAGEKQATQRDAINFRWRR
SLIRR
TATEECEEYCEDEEKTCCGLEDGEPVCATTCL
G
P05629 Pu6.34 precursor O3 superfamily Conus pulicarius
MSGLGIMVLTLLLLVFMATS
HQDAGDKQAMQRDAINVRRRR
SITRR
AVDEECNEYCEERKDKNCCGRTNGEPRCATMCF
G
P05631 Pu6.35 precursor O3 superfamily Conus pulicarius
MSGLGIMVLTLLLLVFMVTS
HQDAGDKQAMQRDAINVRRRR
SITRR
TVTEACEESCEEEEKEEEKHCCHVNNGVPSCARICW
G
P05635 Pu6.36 precursor O3 superfamily Conus pulicarius
MSGLGIMVLTLLLLVFMATS
HQDAGDKQAMQRDAINVRRRR
SITRRRSITRR
TVTEACEESCEEEEKHCCHVNNGVPSCARI
CW
G
P05636 Pu6.37 precursor O3 superfamily Conus pulicarius
MSGLGIMVLTLLLLVFMATS
HQDAGVKRLMLRNKLQKR
TCS
SSSDCPTGQECCPDKLDEPEGSCANECIIT
P06089 S6.16 precursor O3 superfamily Conus striatus (Striated cone)
MSGLGIMVLTLLLLVFMATS
HQDAGEKQATQRDAISVIGRR
SIIRRR
VDEECNEICGEQGKNCCGRSNGTPRCAKVCF
G
P06152 S6.16 precursor O3 superfamily Conus striatus (Striated cone)
MSGLGIMVLTLLLLVFMATS
RQDAGEKQATQRDAISVIGRR
SIIRRR
VDEECNEICGEQGKNCCGRSNGTPRCAKVCF
G
P06088 S6.17 precursor O3 superfamily Conus striatus (Striated cone)
MSGLGIMVLTLLLLVFMATS
RQDAGEKQATQRDAIKVIRR
S
VIQRKATEECEEVCEQDEKHCCDGSDGTPRCTSRCF
G
P06090 S6.18 precursor O3 superfamily Conus striatus (Striated cone)
MSGLGIMVLTLLLLVIMA
TSHQDAGEKQMTQRDAINVRRRR
SITGRVVTEACEEACEQEEKNCCGITNGQPFCNFPCI
G
P06084 Tr7.3 precursor O3 superfamily Conus terebra
MSGLGIMVLTLLLLVFMVTS
HQDSGEKQATRRNAVNIGWRR
SIIRR
TTEECHEYCEDQNKNCCGLTDGEPRCAGMCL
G
P06085 Tr7.4 precursor O3 superfamily Conus terebra
MSRLGIMVLTLLLLVFMVTS
HQDSREKQATRRNAVNIGWRR
SIIRR
TVGEECNEYCEQRNKNCCGKTNGEPVCAQACL
G
P06087 Tr7.5 precursor O3 superfamily Conus terebra
MSGLGIMVLTLLLLVFMVTS
HQDSGEKRATRRNAINIGWRR
SIIRR
ASLDEECNEYCKQRTKNCCGKTNEEPVCARRCL
G
P00749 Ts6.4 precursor O3 superfamily Conus tessulatus
MSGLGIMVLTLLLLVFMATSHQ
DAGEKQATQRDAINVRRRR
SITRR
VDEECNEYCDDRNKECCGRTNGHPRCANVCF
G
P00750 Ts6.5 precursor O3 superfamily Conus tessulatus
MSGLGIMVLTLLLFMFMATSHQ
DAGEKQATQRDAINVRRRR
SITRR
GDEECNEHCEDRNKECCGRTNGHPRCANVCF
G
P00751 Ts6.6 precursor O3 superfamily Conus tessulatus
MSGLGIMVLTLLLFMFMATSHQ
DAGEKQATQRDAINVRRRR
SITRR
GDEECNEYCDDRNKECCGRTNGHPRCANVCF
G
P00752 Ts6.7 precursor O3 superfamily Conus tessulatus
MSGLGIMVLTLLLLVFMATSHQ
DAGEKQATQRDAVNVRRRR
SIAGRTTTEECDEYCEDLNKNCCGLSNGEPVCATACL
G
P06083 Tx7.32 precursor O3 superfamily Conus textile (Cloth-of-gold cone)
MSGLGIMVLTLLLLVFMATS
HQDAGEKQATQRDAINVRRRR
SLARR
TVTEECEEDCEDEEKHCCNTNNGPSCARLCF
G
P04518 Vi6.7 precursor O3 superfamily Conus virgo
MSGLGIMVLTLLLLVFMVTSHQ
DSGEKRATQRNAINVRRRR
SIIRR
TVDEACNEYCEERNKNCCGRTDGEPVCAQACL
G
P00763 Vn6.19 precursor O3 superfamily Conus ventricosus
MSGLGIMVLTLLLLVSMATS
HQDGGGKQATQRDAINVRRRR
SITRR
VVTEACEEYCEDRDKKTCCGLENGEPFCATLCF
G
P00764 Vn6.20 precursor O3 superfamily Conus ventricosus
MSGLGIMVLALLLLVFMATS
HQDGGGKQATQRDAINVRRRR
SITRR
VVTETCKEYCEDRDKTCCGLENGQPDCANLCL
G
P00767 Vn6.21 precursor O3 superfamily Conus ventricosus
MSGLEIMVLTLLLLVSMATS
HQDGGEKQATQRDAINVRRR
S
ITRTEACYEYCKEQNKTCCGISNGRPICVGGCI
R
P00765 Vn6.21 precursor O3 superfamily Conus ventricosus
MSGLGIMVLTLLLLVSMATS
HQDGRGKQATQRDAINVRRRR
SITRTEACYEYCKEQNKTCCGISNGRPICVGGCI
R
P00766 Vn6.22 precursor O3 superfamily Conus ventricosus
MSGLGIMVLTLLLLVSMATS
HQDGGGKQATQRDAINVRRRR
SITRR
EVVTEECEEYCKEQNKTCCGLTNGRPRCVGVCF
G