Protein List

Your search: Gene superfamily in [O3 superfamily] and Protein Type in [Precursor]

Found 55 entries.


ID Name Gene superfamily Organism Sequence
P00753 Ar6.20 precursor O3 superfamily Conus arenatus
MSRLGIMVLTLLLLVYMATS
HQDAGEKQATQRDAINFRWKR
SLTRR
TATEECEESCEEEEKTCCGE.DGEPVCARFCL
G
P00754 Ar6.21 precursor O3 superfamily Conus arenatus
MSRLGIMVLTLLLLVFIVTS
HQDAGEKQATQRNAINFRWRR
SFTRR
AATEECEEYCEDEEKTCCGLEDGEPVCATTCL
G
P00755 Ar6.22 precursor O3 superfamily Conus arenatus
MSRLGIMVLTLLLLVFIVTS
HQDAGEKQATKRAAVNFRWRR
SFTRR
AAAEECEEYCEEEEKTCCGEEDGEPVCAEFCL
G
P00758 Ar6.24 precursor O3 superfamily Conus arenatus
MSRLGIMVLTLLLLVFIVTS
HQDAGEKQATQRAAINFRWKR
SLTRR
TATEECEEYCEDEEKTCCGEEDGEPVCARFCL
G
P00756 Ar6.24 precursor O3 superfamily Conus arenatus
MSRLGIMVLTLLLLVFIVTS
HQDAGEKQATHRGAINFRWRR
SLIRR
TATEECEEYCEDEEKTCCGLEDGEPVCATTCL
G
P00759 Ar6.25 precursor O3 superfamily Conus arenatus
MSGLGIMVLTLLLLVFMETSHQ
DAGEKQAMQRDAINVRRRR
SITRR
VSEACEESCEEEEKHCCHENNGVYTCLRYCW
G
P00760 Ar6.26 precursor O3 superfamily Conus arenatus
MSGLGIMLLTLLLLVFMETSHQ
DAGEKQATQRDAINVRRRR
SLTRR
VTEECEENCEEEEKHCCNTNNGPSCAPQCF
G
P00757 Ar6.27 precursor O3 superfamily Conus arenatus
MSGLGILVLTLLLLVYMATS
HQDAGEKQATQRDAINVRRRR
SLTRR
VAEECEESCEDEEKHCCNTNNGPSCAPQCF
G
P04227 Bromosleeper peptide precursor O3 superfamily Conus radiatus
MSGLGFMVLTLLLLTFMATSHQ
DRGEKQATQRHAINVIRRR
LITR
WATIDECEETCNVTFKTCCGPPGDWQCVEACPV
P07725 Ca6.28 precursor O3 superfamily Conus caracteristicus
MSGLGMMVLTLLLLVFMETSHQ
DAGEKKATQRDAINVRRRR
SLAQR
TVTEECEESCEDEEKHCCNTNNGPSCARICF
G
P07726 Ca6.29 precursor O3 superfamily Conus caracteristicus
FMET
SHQDAGEKQSTQRDAINVRQGRSLTRR
KVPEACEESC
EEEEKHCCNTSNGLSCVRHCL
G
P07727 Ca6.30 precursor O3 superfamily Conus caracteristicus
EKQAMERDAINIRWRRSLTRR
IVTEECEEYCEDEEKDCCGL
QNGQPFCAPFCL
G
P02723 CaFr179 precursor O3 superfamily Conus caracteristicus
MSGLGIMVLTLLLLVFMEA
SHQDAGEKQATQRDAINVRRRR
SLARR
TVTEECEEDCEDEEKHCCNTNNGPSCARLCF
G
P05921 Di6.11 precursor O3 superfamily Conus distans
MSGLGFMVVTLLLLVPMATS
QQDGGEKQAMQR
DAINVAPGT
SITRTETDQECIDTCKQEDKKCCGRSNGVPTCAKICL
G
P05922 Di6.12 precursor O3 superfamily Conus distans
MSGLGFMVLTFLLLVSMATS
KQDGRVRRRMLHTR
LVEGACT
SPSNCPTGQECCPDKLDEPEGSCANSCPFY
P05939 Di6.6 precursor O3 superfamily Conus distans
MSGLGFMVLTLLLLVPMATS
QQDGGEKQAMQR
DAINVAPGT
SITRTETDQECIDICKQEDKKCCGRSNGEPTCAKICL
G
P05940 Di6.7 precursor O3 superfamily Conus distans
MSGLGFMVLTLLLFVPMATS
QQDGGEKQAMQR
DAINVAPGT
SIIGTETNQECIDICKQEDKNCCGKSNGVPTCGKICL
G
P04572 Eu6.6 precursor O3 superfamily Conus eburneus
MSGLGIMVLTLLLLVFMATSHQ
HRGGKQLMLRNNLQKR
TCS
SPSNCPTGQECCPDKVDEPEGFCADECIIT
P05747 G27 precursor O3 superfamily Conus geographus (Geography cone)
MSGLGIMVLTLLLLVSMAIS
HRYAREKQATRRDVVNIRRR
S
KPKTPECKRICKLEEKKCCCVRSEGPKCSRLCGLPMFC
P05735 G6.6 precursor O3 superfamily Conus geographus (Geography cone)
MSGLRIMVLTLLLLVLMTTSHQ
DAGEKQAMQRDAKNFSRRR
LGIRKPKTR
ECEMLCEQEEKHCCRIRNENIQCAPRCLGIGV
P07788 Ge6.18 precursor O3 superfamily Conus generalis
MSGLGIMVLTLLLLVSMATNHQ
DGRVRRLMLRNRLR
QMMCT
TDEDCPTGQECCPDNINDPQGFCVDDCIV
P07789 Ge6.19 precursor O3 superfamily Conus generalis
MSGLGIMVLTLLLLVFMETS
HQDAGEKQATQRDAINVRRRR
SLTRR
VVTEACEESCEDEEKTCCGLENGEPVCARFCL
G
P02722 LiCr173 precursor O3 superfamily Conus lividus
MSGLGTMVLTLLLLVFMVTSHQDGG
KKQATQRNAVNIRRRK
SITQR
TTDEKCNEYCEERDRNCCGKANGEPRCARMCF
G
P06323 O3_Vc1 precursor O3 superfamily Conus victoriae
MSGLGIMLLALLLLVSLETSLQG
GGEGQAMHRDKNQQGRRR
ILLRRALQKSRKPPQGTKKSASLDFQVPVVLA
P00761 Pn6.10 precursor O3 superfamily Conus pennaceus
MSGLGIMVLTLLLLVFMETSHQ
DAGEKQAMQRDAINVRRRR
SITRR
VSEACEESCEDEEKHCCHENNGVYTCLRYCW
G
P00762 Pn6.11 precursor O3 superfamily Conus pennaceus
MSRLGIMVLTLLLLVFIVTS
HQDAGEKQATQRDAINFRWRR
SLIRR
TATEECEEYCEDEEKTCCGLEDGEPVCATTCL
G
P05629 Pu6.34 precursor O3 superfamily Conus pulicarius
MSGLGIMVLTLLLLVFMATS
HQDAGDKQAMQRDAINVRRRR
SITRR
AVDEECNEYCEERKDKNCCGRTNGEPRCATMCF
G
P05631 Pu6.35 precursor O3 superfamily Conus pulicarius
MSGLGIMVLTLLLLVFMVTS
HQDAGDKQAMQRDAINVRRRR
SITRR
TVTEACEESCEEEEKEEEKHCCHVNNGVPSCARICW
G
P05635 Pu6.36 precursor O3 superfamily Conus pulicarius
MSGLGIMVLTLLLLVFMATS
HQDAGDKQAMQRDAINVRRRR
SITRRRSITRR
TVTEACEESCEEEEKHCCHVNNGVPSCARI
CW
G
P05636 Pu6.37 precursor O3 superfamily Conus pulicarius
MSGLGIMVLTLLLLVFMATS
HQDAGVKRLMLRNKLQKR
TCS
SSSDCPTGQECCPDKLDEPEGSCANECIIT
P07836 Qc6.16 precursor O3 superfamily Conus quercinus
MSGLGTMVLTLLLLVFMVTS
HQDGGEKQATQRNAINVGRRK
SITRR
TVDEECNEYCEDRDQNCCGKTNGEPRCAGICL
G
P06089 S6.16 precursor O3 superfamily Conus striatus (Striated cone)
MSGLGIMVLTLLLLVFMATS
HQDAGEKQATQRDAISVIGRR
SIIRRR
VDEECNEICGEQGKNCCGRSNGTPRCAKVCF
G
P06152 S6.16 precursor O3 superfamily Conus striatus (Striated cone)
MSGLGIMVLTLLLLVFMATS
RQDAGEKQATQRDAISVIGRR
SIIRRR
VDEECNEICGEQGKNCCGRSNGTPRCAKVCF
G
P06088 S6.17 precursor O3 superfamily Conus striatus (Striated cone)
MSGLGIMVLTLLLLVFMATS
RQDAGEKQATQRDAIKVIRR
S
VIQRKATEECEEVCEQDEKHCCDGSDGTPRCTSRCF
G
P06090 S6.18 precursor O3 superfamily Conus striatus (Striated cone)
MSGLGIMVLTLLLLVIMA
TSHQDAGEKQMTQRDAINVRRRR
SITGRVVTEACEEACEQEEKNCCGITNGQPFCNFPCI
G
P07983 T16.1 precursor O3 superfamily Conus tulipa (tulip cone)
MSGLGIMVLTLLLLVLMTTSH
QDAGEKQAMQRDAKNFSRRR
LVIRRPKTRE
CEMQCEQKKKHCCRVKRRKDPMCP
P06084 Tr7.3 precursor O3 superfamily Conus terebra
MSGLGIMVLTLLLLVFMVTS
HQDSGEKQATRRNAVNIGWRR
SIIRR
TTEECHEYCEDQNKNCCGLTDGEPRCAGMCL
G
P06085 Tr7.4 precursor O3 superfamily Conus terebra
MSRLGIMVLTLLLLVFMVTS
HQDSREKQATRRNAVNIGWRR
SIIRR
TVGEECNEYCEQRNKNCCGKTNGEPVCAQACL
G
P06087 Tr7.5 precursor O3 superfamily Conus terebra
MSGLGIMVLTLLLLVFMVTS
HQDSGEKRATRRNAINIGWRR
SIIRR
ASLDEECNEYCKQRTKNCCGKTNEEPVCARRCL
G
P00749 Ts6.4 precursor O3 superfamily Conus tessulatus
MSGLGIMVLTLLLLVFMATSHQ
DAGEKQATQRDAINVRRRR
SITRR
VDEECNEYCDDRNKECCGRTNGHPRCANVCF
G
P00750 Ts6.5 precursor O3 superfamily Conus tessulatus
MSGLGIMVLTLLLFMFMATSHQ
DAGEKQATQRDAINVRRRR
SITRR
GDEECNEHCEDRNKECCGRTNGHPRCANVCF
G
P00751 Ts6.6 precursor O3 superfamily Conus tessulatus
MSGLGIMVLTLLLFMFMATSHQ
DAGEKQATQRDAINVRRRR
SITRR
GDEECNEYCDDRNKECCGRTNGHPRCANVCF
G
P00752 Ts6.7 precursor O3 superfamily Conus tessulatus
MSGLGIMVLTLLLLVFMATSHQ
DAGEKQATQRDAVNVRRRR
SIAGRTTTEECDEYCEDLNKNCCGLSNGEPVCATACL
G
P07978 Tu043 precursor O3 superfamily Conus tulipa (tulip cone)
MSGLGIMVLTLLLLVSMA
TSHRYAREKQATRRDAVNVRRR
S
RPKTKECERYCELEEKHCCCIRSNGPKCSRICIFKFWC
P07979 Tu044 precursor O3 superfamily Conus tulipa (tulip cone)
MSGLGIMVLTLLLLVLMTTSH
QDAGEKQAMQRDAKNFSRRR
LVIRRPKQGSAKCSVSRRRNTAAA
P07980 Tu045 precursor O3 superfamily Conus tulipa (tulip cone)
MSGLGTMVLTLLLLVLMTTSH
QDAGEKQAMQRDAKNFSRRR
LVIRRPKQGSAKCSVSRRRNTAAA
P07981 Tu046 precursor O3 superfamily Conus tulipa (tulip cone)
MSGLGTMVLTLLLLVLMTTSH
QDAGEKQAMQRDAKNFSRRR
LVIRRPKTGSAKCSVSRRRNTAAA
P07982 Tu047 precursor O3 superfamily Conus tulipa (tulip cone)
MSGLGIMVLTLLLLVLMTTSH
QDAGEKQAMQRDAKNFSRRR
LVIRRPKTGSAKCSVSRRRNTAAA
P06083 Tx7.32 precursor O3 superfamily Conus textile (Cloth-of-gold cone)
MSGLGIMVLTLLLLVFMATS
HQDAGEKQATQRDAINVRRRR
SLARR
TVTEECEEDCEDEEKHCCNTNNGPSCARLCF
G
P04518 Vi6.7 precursor O3 superfamily Conus virgo
MSGLGIMVLTLLLLVFMVTSHQ
DSGEKRATQRNAINVRRRR
SIIRR
TVDEACNEYCEERNKNCCGRTDGEPVCAQACL
G
P00763 Vn6.19 precursor O3 superfamily Conus ventricosus
MSGLGIMVLTLLLLVSMATS
HQDGGGKQATQRDAINVRRRR
SITRR
VVTEACEEYCEDRDKKTCCGLENGEPFCATLCF
G
P00764 Vn6.20 precursor O3 superfamily Conus ventricosus
MSGLGIMVLALLLLVFMATS
HQDGGGKQATQRDAINVRRRR
SITRR
VVTETCKEYCEDRDKTCCGLENGQPDCANLCL
G
P00765 Vn6.21 precursor O3 superfamily Conus ventricosus
MSGLGIMVLTLLLLVSMATS
HQDGRGKQATQRDAINVRRRR
SITRTEACYEYCKEQNKTCCGISNGRPICVGGCI
R
P00767 Vn6.21 precursor O3 superfamily Conus ventricosus
MSGLEIMVLTLLLLVSMATS
HQDGGEKQATQRDAINVRRR
S
ITRTEACYEYCKEQNKTCCGISNGRPICVGGCI
R
P00766 Vn6.22 precursor O3 superfamily Conus ventricosus
MSGLGIMVLTLLLLVSMATS
HQDGGGKQATQRDAINVRRRR
SITRR
EVVTEECEEYCKEQNKTCCGLTNGRPRCVGVCF
G