Protein List

Your search: Gene superfamily in [R superfamily] and Protein Type in [Precursor]

Found 1 entry.


ID Name Gene superfamily Organism Sequence
P07651 VilXIVa precursor R superfamily Conus villepinii
MGFRVLVLVVMATTSALPFTFS
EEPGRSPFRPALRSEEAQA
LRHGLTLLLARRADGQPPDMRQPEMRRPEVRRPEVRQPEFA
ETPVGQKR
GGLGRCIYNCMNSGGGLSFIQCKTMC