Protein List

Your search: Gene superfamily in [S superfamily] and Protein Type in [Precursor]

Found 21 entries.


ID Name Gene superfamily Organism Sequence
P02822 Ac8.1 precursor S superfamily Conus achatinus
LKMGAMFVLLLLFTLASS
QQEGDVQARKTSLKSDFYRALRQ
YDR
QCTLVNNCDRNGERACNGDCSCEGQICKCGYRVSPGKS
GCACTCRNA
K
P02824 Ca8a precursor S superfamily Conus caracteristicus
MMLKMGAMFVLLLLFILPSSQQ
EGDVQARKTHLKRGFYGTL
AMSTR
GCSGTCHRREDGKCRGTCDCSGYSYCRCGDAHHFYR
GCTCTC
P02823 Ca8b precursor S superfamily Conus caracteristicus
MMLKMGAMFVLLLLFILPSSQQ
EGDVQARKTHLKRGFYGTL
AMSTR
GCSGTCHRREDGKCRGTCDCSGYSYCRCGDAHHFYR
GCTCSCQ
G
P02827 Ca8c precursor S superfamily Conus caracteristicus
MMLKMGAMFVLLLLFILPSSQQ
EGDVQARKTHLKSGFYGTL
AMSTR
GCSGTCRRHRDGKCRGTCECSGYSYCRCGDAHHFYR
GCTCTC
P05545 CCo_S_a precursor S superfamily Conus consors
MFVLLLLFTLASSQQ
EGDVQARKTSLKSDFYRALRKYNKR
E
CVFDCGTDCSGSCSCDNAPFDWCSCSGPTSKGCKCTCRCRN
PTEC
P05549 Cco_S_c precursor S superfamily Conus consors
MFVLLLLFTLASSQQ
EGDVQARKTRLKSDFYRAWR
GCTLVN
NCRKRNGACNGDCHCKGKICKCSSSARPWKPGCACTCRNA
K
P05551 Cco_S_d precursor S superfamily Conus consors
MFVLLLLFTLASSQQ
EGDVQARKTRLKSDFYRAWR
GCTLVN
NCEKNGACNGDCHCKGKICRCSSSARPWKPGCACTCRNA
K
P01109 conotoxin precursor S superfamily Conus striatus (Striated cone) GDCSCEGQICKCGYRVSPGKSGCACTCRNAK
P05923 Di8.1 precursor S superfamily Conus distans
MMLKMGAMFVLLLLCSFTFTNIKA
RRTFWKRDLYGDLAGR
S
SCSGTCYDSANCDGTCYCREDNCWCTGDLSCACQCA
P05771 G8.2 precursor S superfamily Conus geographus (Geography cone)
MMSKMGAMFDLLLLFTLASS
QQEGDVQARKTRLKSGFHRAL
AMDDR
GCTRTCGGADCTGSCECTFSSNCGCEFHGGPGAWGC
ACVCS
G
P05773 G8.3 precursor S superfamily Conus geographus (Geography cone)
MMSKMGAMFVLLLLFTLASS
QQEGDVQARKTRPKSDFYRAL
PR
SGSTCTCFTSTNCQGSCECLSPPGCYCSNNGIRQRGCSC
TCPGT
G
P05777 G8.5 precursor S superfamily Conus geographus (Geography cone)
MMSKMGAMFVLLLLFTLASS
LQEGDVQARKTRLKSDFYR
AL
ADVGECTHCGGADCTGSCTCTNWSSCVCKYFSSSGAGECGC
ACYD
P01724 GVIIIA precursor S superfamily Conus geographus (Geography cone)
MMSKMGAMFVLLLLFTLASS
LQEGDVQARKTRLKSDFYRAL
ARDDR
GCTRTCGGPKCTGTCTCTNSSKCGCRYNVHPSGWGC
GCACS
G
P05390 Mr016 precursor S superfamily Conus marmoreus
MMSKMGAMFVLLLLFTLPSSQR
EEDVQARKTHPKSDFYGTR
PRSAER
CTDSCEFQGRFVSGYLRLLRNKQLLLCHKP
P05392 Mr8.1 precursor S superfamily Conus marmoreus CLSFCLLFTLPSSQREEDVQARKTHPKSDFYGTRPRSAER
C
TDSCEFQGVLCRGTCDCYGTNNCYCAINHNKQCICVCTN
P04000 RVIIIA precursor S superfamily Conus radiatus
MMSKMGAMFVLLLLFTLAS
SQQEGDVQARKTHPKREFQRIL
LRSGR
KCNFDKCKGTGVYNCGESCSCEGLHSCRCTYNIGSM
KSGCACICTYY
P06091 S8.1 precursor S superfamily Conus striatus (Striated cone)
MMLKMGAMFVLLLLFILPSSQQ
EGDVQARKTHLKRGFYGTL
AMSTR
GCSGTCHRREDGKCRGTCDCSGYSYCRCGDAHHFYR
GCTCSCQ
G
P06092 S8.2 precursor S superfamily Conus striatus (Striated cone)
MMLKMGAMFVLLLLFTLASVQQ
EDVQARKTRLKRDFHRALR
QSPLGCPGTCGKGGKCVGSCECTMYKNCYCSNNGIRQPGCS
CTCPT
R
P02821 Tx8.1 precursor S superfamily Conus textile (Cloth-of-gold cone)
LKMGAMFVLLLLFTLASS
HREGDIQARKTHLKSDFYRTLPR
FAR
GCTISCGYEDNRCQGECHCPGKTNCYCTSGHHNKGCGC
AC
P06140 Tx8.1 precursor S superfamily Conus textile (Cloth-of-gold cone)
MMLKMGAMFVLLLLFTLASS
QQEGDIQARKTHLKSGFYRTL
PRFAR
GCTISCGYEDNRCQGECHCPGKTNCYCTSGHHNKGC
GCAC
P06318 Vc8.1 precursor S superfamily Conus victoriae
MSNMGAMFVLLLLFTLASS
QWEEDVQARKTHLKSDFYRTLP
RFAR
GCTISCEYQDNRCRGECHCPGKTNCYCTSGHHNKGCG
CAC