Protein List

Your search: Gene superfamily in [T superfamily] and Protein Type in [Precursor]

Found 235 entries.


ID Name Gene superfamily Organism Sequence
P00676 Ar5.1 precursor T superfamily Conus arenatus
MLCLPVFIILLLLASPAAS
NPLETRIQSDLIR
AALEDADMK
NEKNILSSIMGSLGTIGNVVGNVCCSITKSCCASEE
P00780 Ar5.1 precursor T superfamily Conus arenatus
MLCLPVFIILLLLASPAAS
NPLKTRIQSDLIR
AALEDADMK
NEKNILSSIMGSLGTIGNVVGNVCCSITKSCCASEE
P00678 Ar5.2 precursor T superfamily Conus arenatus
MLCLPVFIILLLLASPAAS
NPLEKRIQSDLIRAALEDADTK
NDPR
LLGLVTGACCAVLKFSFCC
GKK
P00679 Ar5.3 precursor T superfamily Conus arenatus
MLCLPVFIILLLLASPAAS
NPLEKRIQNDLIRAALEDADME
NDPR
SIIDSVKTFCCSTFNLGICCS
KK
P00689 ArMLCL-022 T superfamily Conus arenatus
MLCLPVFIILLLLASTAA
SNPLETRIQSDLIRAALEDADMK
TERGFLGVLMKGLKYLGKVVPIGSLVKDLLSSSDE
P01674 BeB34 precursor T superfamily Conus betulinus
MRGLPVFVILLLLIASEPSVDA
RPKTKADVPLTSLNDNAKR
TLQILRNKR
ACCPYEPSCCI
P06122 Bt5.2 precursor T superfamily Conus betulinus
MLCLPVFIILLLLVSPAAT
LLVKSKLHGFLTRRSLKDFWKR
HFYLRDEDWVDCCQMGDCCDE
K
P06123 Bt5.3 precursor T superfamily Conus betulinus
MLCLPVFIILPVLSSAAG
FPVESELQRDLTQESPKDLGMRN
EHQLLKK
VADDCCVGKVGTCC
R
P06124 Bt5.4 precursor T superfamily Conus betulinus
MLCLPVFIILLLLVSPAAT
LPVTSKLHGLLTRRSLKNFWKR
NLYLR
DEDWVDCCHMPRCCVED
P02815 Ca5.1 precursor T superfamily Conus caracteristicus
MRCVPVFIILLLLASPAAS
DPLEKRIQSDLIRAALEDADTK
NDPRILEDIVSTALA
TCCKFQFLNFCCNE
K
P02817 Ca5.2 precursor T superfamily Conus caracteristicus
MRCVPVFLILLGLIASAPSVDA
RPQTKDDALASFHDSAKRH
LQRLVNARK
CCPESPPCCHYF
GRRK
P02819 Ca5.3 precursor T superfamily Conus caracteristicus
MRCVPVFIILLLLIASAPGVDA
QPKTKYNAPLTSLHDNAKG
ILQEHWNKR
CCPRRLACCII
GRK
P02964 Ca5.3 precursor T superfamily Conus caracteristicus
MRCLPVFIILLLLIASAPGVDA
QPKTKYNAPLTSLHDNAKG
ILQEHWNKR
CCPRRLACCII
GRK
P02966 Ca5.4 precursor T superfamily Conus caracteristicus
MRCLPVFIILLLLIASAPGVDA
QPKTKYDAPLTSLHDNAKG
ILQEHWNKR
CCPNKPCCFI
GRK
P06113 Ca5.5 precursor T superfamily Conus caracteristicus
MRCFPVFIILLLLISSASNVDA
QQKTKDDASLASFQDNARR
TLQSLWMTRGCCPGNVLCC
GK
P06114 Ca5.6 precursor T superfamily Conus caracteristicus
MLCLPVFIILLLLASPAAP
NPFETRLLNDLARADADMETEK
YLGEVR
KAVCCQVFPGSDCCPGF
P03985 Cal1a precursor T superfamily Conus californicus
MRCLPVFIILLLLASTAA
VDVAGSKLKRRLERKPYQGSQAY
VKK
TAFGLRKCCKRHHGCHPC
GRK
P03986 Cal1b precursor T superfamily Conus californicus
MRCLPVFIILLLLASTAA
VDVAGSKLKRRLERKPYQGSQAY
VKK
TAFGLRLCCKRHHGCHPCGRT
P03984 Cal5.2 precursor T superfamily Conus californicus M
MYCLPVVCILLLLIPSS
ATFVVESRLEKDQAQSFTGDAWK
RVSPIHEMIQR
SQCCAVKKNCCHV
G
P06115 Cap5.1 precursor T superfamily Conus capitaneus
MLCLPVFIILLLLISSASNVDA
QQKTKDDASLAPFQDNARR
TLQSLWMTRGCCPGNVLCC
GK
P04003 Cl1.1 precursor T superfamily Conus californicus
MRCLPVIVILLLLISSAA
AVVEGPLRVNRRLRPRKAPVDMQ
ARDWNWGR
CCFLSGCFECW
P04005 Cl1.3 precursor T superfamily Conus californicus
MRCLPVFIILLLLASTAA
VDVAGSKLKRRLERKPYQGSQAY
VKK
TAFGLRKCCKKHHGCHPC
GRK
P05120 CMrX precursor T superfamily Conus marmoreus
MRCLPVLIILLLLTASAP
GVDVLPKTEDDVPLSSVYGNGKS
ILRGILRK
GICCGVSFCYPC
P06116 Co5.1 precursor T superfamily Conus coronatus
MLCLPVFIILLLLASPAVP
EPFETKLQRDLTRADADMENLA
KVR
KAVCCEVLPGTDCCF
G
P00683 conotoxin precursor T superfamily Conus tessulatus
MLCLPVFIILLLLASPAAP
NPLERRIQSDLIRAVLEDADMK
TEKGILSSIMGALGGIVG
P00669 conotoxin precursor T superfamily Conus pennaceus
MRCLPVFVILLLLIASTPSIDA
RPKTKDDVPLSSFHARPKT
KDDVPLSSFRGNAERTQQRAMEPWTRVV
P01107 Conotoxin precursor T superfamily Conus striatus (Striated cone)
MLCLPVFIMLLLLASPAAP
NPLETRTQSDLIRAALEDADAK
PDERFLGGIFGGISLLSALINALSS
P00666 conotoxin precursor T superfamily Conus pennaceus
MRCLPVFVILLLLIASGPSIDA
RPKTKDDVPLSSFHARPKT
KDDVPLSSFRGNAERTQQRAMEPWTRVV
P06134 Eb5.1 precursor T superfamily Conus ebraeus
MRCFPVFVVLLLLIASAPSVDA
QPKTKDDVPLAPLHDNIQN
TLQTLRKK
VCCRPMQDCCS
GK
P06135 Eb5.2 precursor T superfamily Conus ebraeus
MRCFPVFVTLLLLIASAPSVDA
RPKTKDGMPLASFHDNATR
NLQILCCKHSLECCT
GK
P06136 Eb5.3 precursor T superfamily Conus ebraeus
MRCFPVFVILLLLIASAPSVDA
RPKTKDGMPLASFHDNATR
NLQILCCKHTPACC
K
P06137 Eb5.4 precursor T superfamily Conus ebraeus
MRCLPVFVILLLLIASAPSVDA
RPKTKDGMPLASFHDNATR
NLQILCCKHTPKCCT
GK
P06138 Eb5.5 precursor T superfamily Conus ebraeus
MRCFPVFVILLLLIASAPSVDA
RPKTKDGMPLASFHDNATR
NLQILCCKHTPACCT
GK
P06133 Ec5.1 precursor T superfamily Conus emaciatus
MLCLPVFITLLLLISSAPSVDA
QTKTKNFLTLASLRDFAKK
SPKR
LTQFECCSEVFSCC
R
P05117 Eu5.4 precursor T superfamily Conus eburneus
MLCLPVFIILLLLASPAAP
KSFETKVQSDLTRTDGNMETEE
NLDGNMETEENLGEVR
KVPCCLGVRDDWCCAGQIQI
P02957 G5.1 precursor T superfamily Conus geographus (Geography cone)
MCCLPVFVILLLLITSAPSVDA
LPKTRDDVPLASFHGGYNA
RRILQRR
QGWCCKENIACCV
P02953 G5.2 precursor T superfamily Conus geographus (Geography cone)
MCCLPVFVILLLLITSAPSVDA
LPKTRDDVPLASFHGGYNA
RRILQRR
QGWCCKENIACCI
P05761 G5.3 precursor T superfamily Conus geographus (Geography cone)
MLCLRVLIILLLLASPAAS
NPLETRIQSDLIR
AALEDADIK
TEKGFLGSVFSNLGGITDLATGICCAIIERCCV
K
P05763 G5.4 precursor T superfamily Conus geographus (Geography cone)
MPCLPVFIILLLLISSAPSVDA
RPKTKYDVSRASFHVNAKR
DRQSRWMER
DCCEERWCCF
R
P05765 G5.5 precursor T superfamily Conus geographus (Geography cone)
MQCLPVFTILLLLASTAAP
NPLETRIQSDLTRADLEDSDTK
TDERFITGLLGGLSAVGGITSLASR
ICCAITDSCC
P05767 G5.6 precursor T superfamily Conus geographus (Geography cone)
MLSLPVFIILLLLASPAAP
IPLETRIQSDLIR
AALEDADMK
NEKGLLNGLVGNLGEIGEIISTVCCSVYPKCCVE
K
P05769 G5.6 precursor T superfamily Conus geographus (Geography cone)
MLCLPVFIILLLLASPAAP
KPFETKLPSDLTR
ADVDIDMAV
FLEKLQDACCKNAPEFGCCT
R
P00857 Gla-MrIII precursor T superfamily Conus marmoreus
MRCVPVFVILLLLIASAPT
VDAQLKTKDDMPLASFHANVKR
TLQILRDKR
FCCRTQEVCCEAIKN
G
P05472 Gla-MrIII precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPTVDA
QLKTKDDMPLASFHANVKR
TLQILRDKR
FCCRTQEVCCEAIKN
G
P00858 Gla-MrIV precursor T superfamily Conus marmoreus
MRCVPVFVILLLLIASVPS
VDAQLKTKDDMPLASSHANVKR
TLQILRNKR
CCITFESCCEFDL
K
P01731 Gm5.1 precursor T superfamily Conus gloriamaris
MRYLPVFVILLLLIASIPSDT
VQLKTKDDMPLASFHGNGRR
ILRMLSNKR
LCCVTEDWCCEWW
P01732 Gm5.2 precursor T superfamily Conus gloriamaris
MRCLPVFVILLLLIASAPSVDA
QPKTKDDVPLAPLHDNIRS
TLQTLRKK
VCCRPVQDCCS
GK
P01734 Im5.1 precursor T superfamily Conus imperialis
MYCLPVFIILLLLISSAPS
TPPQPRNKDRVHLISLLDNHKQ
ILQR
DWNSCCGKNPGCCPWGK
P05122 Im5.10 precursor T superfamily Conus imperialis
MCCIPVFIILLLLIPSAPSILG
QPTTKGDVALASSYDDAKR
ILQRYLDHPWCCAVKYSCCVPGIIPI
P05119 Im5.11 precursor T superfamily Conus imperialis
MCCIPVFFILLLLIPSAPSILA
QPTTKGDVALASSYDDAKR
TLQRLSIEYSCCPGIVSCCVIP
P05118 Im5.4 precursor T superfamily Conus imperialis
MRCLPVVVFLLLLLSAAA
APGVGSKTER
LPGLTSSGDSDES
LPFLNTICCWSGACCG
G
P05121 Im5.5 precursor T superfamily Conus imperialis
MYCLPVFIILLLLIPSAP
SVDVQPITKNDVILDSLRNVATK
PLQRLLNTR
CCIKFHPCCHN
G
P05123 Im5.6 precursor T superfamily Conus imperialis
MYCLPVFLILLLLISSAP
STPPQPRNKDRVNLVSLLDNQKQ
ILQR
DWNGCCVKKAGCCPW
GK
P01679 LeDr192 precursor T superfamily Conus litteratus
MRCFPVFIILLLLIASAPC
FDARTKTDDDVPLSPLRDNLKR
TIRTRLNIR
ECCEDGWCCTAAPLT
GR
P01680 LeDr243 precursor T superfamily Conus litteratus
MRCLPVFVILLLLIASTPSIDA
RPKTKDDMPLASFNDNAKR
ILQILSRK
PCCSIHDNSCC
GLG
P01681 LiC121 precursor T superfamily Conus lividus
MRCVPVFIILLLLSPSAPSVDA
HPKTKDDVPLASFHDDAKR
TLQRLWIK
ALCCYGYRFCCPNFR
P01675 LiC32 precursor T superfamily Conus lividus
MRCVPVFIILLLLSPSAPSVDA
HPKTKDDVPLASFHDDAKR
TLQR
LWQNTWCCRDHLRCC
G
P01676 LiC33 precursor T superfamily Conus lividus
MRCVPVFIILLLLSPSAPSVDA
HPKTKDDVPLASFHDDAKR
TLQRLWIK
ALCCYGYRFCCPIF
GKGK
P00860 Lp5.1 precursor T superfamily Conus leopardus
MRCVPVFIILLLLIPSAPSVDA
QRKTKDDVPLASFHDNAKR
TLKRLWNKR
SCCPQEFLCCLYLVK
P00861 Lp5.2 precursor T superfamily Conus leopardus
MRCVPVFIILLLLASPAAP
KSLETRIQNDLIRAGLTDADLK
TEKGFLSGLLNVA
GSVCCKVDTSCCSN
P03013 Lp5.3 precursor T superfamily Conus leopardus
MRCLPVFIILLLLIPSAPSVDA
QPKTEDDVPLASLHDNAKL
TLQGLWDKR
CCPNLFYCCPD
RRK
P03015 Lp5.4 precursor T superfamily Conus leopardus
MRCLPVFIILPLLIPSAPSVDA
QPMTEDDVPLASFHEQTLQ
ELWNKR
PCCPLIPGCC
R
P01138 lt5a precursor T superfamily Conus litteratus
MRCLPVFIILLLLIPSAPSVDA
QRKTKDDVPLASFHDNAKR
TLKRLWNKR
SCCPQEFLCCLYLV
K
P01142 Lt5b precursor T superfamily Conus litteratus
MLCLPVFIILLLLASPAAP
KSLETRIQNDLIR
AGLTDADLK
TEKGFLSGLLNVAGSVCCKVDTSCCSN
P01677 Lt5c precursor T superfamily Conus litteratus
MRFLPVFIILLLLIPSAPSVDA
QPMTKDDVPLSSLHDNAKR
ALQMFWNKR
DCCPAKMFCCQW
P01139 Lt5c precursor T superfamily Conus litteratus
MRCLLVFIILLLLIPSAPSVDA
QPMTKDDVPLSSLHDNAKR
ALQMFWNKR
DCCPAKMFCCQW
P01140 Lt5d precursor T superfamily Conus litteratus
MRCLPVFIILLLLIPSAPSVDA
QPTTKDDVPLASLHDNAKR
ALQMFWNKR
DCCPAKLLCCNP
P01147 Lt5d-1 precursor T superfamily Conus litteratus
MRCLPVFIILLLLIPSAPSVDA
QPTTKDDVPLASLHDNAKR
ALQMFWNKR
DCCPSKLLCCNP
P01148 Lt5d-2 precursor T superfamily Conus litteratus
MRCLPVFIILLLLIPSAPSVDA
QPTTKDDVPLASLHDNAKR
ALQMFWNKR
DCCPANLLCCNP
P01141 Lt5e precursor T superfamily Conus litteratus
MRCLQVFIIFLLLIPSPPSVDA
QRKTKDDVPLASFHDNAKR
TLKRLWNKR
SCCPREFLCCL
R
P01143 Lt5f precursor T superfamily Conus litteratus
MLCLPVFIILLLLASPAAP
KSLETRIQNDLIR
AGLTDADLK
TEKGFLSGLLNVAGSVCCKVDTSCC
P01145 Lt5g precursor T superfamily Conus litteratus
MLCLPVFIILLLLASPAAP
KSLETRIQNDLIR
AGLTDADLK
TEKGFLSGLLNVAGSVCCKVDTSCCSNQ
P01146 Lt5h precursor T superfamily Conus litteratus
MLCLPVFIILLLLVSPAAT
MPVDLEILKAPTKESRKDFEMR
IELLRSKR
QCCRPANMSCCQ
G
P01144 Lt5i precursor T superfamily Conus litteratus
MLCLPVFIILLLLASPAAP
KSFETKVQSDLTRTDGNMETEE
NLGEVR
KVYCCLGVRDDWCCAGQIQI
P01150 Lt5j precursor T superfamily Conus litteratus
MLCLPVFIILLLLASPAAP
KSLETRIQNDLIR
AGLTDADLK
TEKGFLSGLLNVAGSVCCKVDTSCCSSQ
P01149 Lt5k precursor T superfamily Conus litteratus
MLCLPVFIILLLLASPAAP
KSLETRIQNDLIR
AGLTDADLK
TEKGFLSGLLNVADSVCCKVDTSCCSN
P06129 Lv5.4 precursor T superfamily Conus lividus
MLCLPVFIILLLLSPSAPSVDA
HPKTKNDVHRAILHDVAKR
IHLKLGCCIMFTCCM
GR
P06130 Lv5.5 precursor T superfamily Conus lividus
MLCLPVFIIPLLLVSPAAT
LRVQSKLER
FLTQQSPRDFAKS
IMQLLHYNRIDCCNYGVSDCC
K
P06131 Lv5.6 precursor T superfamily Conus lividus
MLCLPVFIILLLLSPSAPSVDA
HPKTKNDVRLDILNDVAKR
IDLR
PGCCARLICCP
GR
P06132 Lv5.7 precursor T superfamily Conus lividus
MLCLPVFIILLLLVSPAAT
LRVQSKLER
FLTQQSPRDFAKS
VMQLLHYNWIDCCNYGVSDCCI
G
P06101 Mi5.1 precursor T superfamily Conus miles
MRCLPVFIILLLLIPSASS
VDVQPLTKDDVPLASFLANARR
TLQSLWMTRR
CCPKKPYCCPG
GK
P06103 Mi5.1 precursor T superfamily Conus miles
MLCLPVFIILLLLIPSASS
VDVQPLTKDDVPLASFLANARR
TLQSLWMTRR
CCPKKPYCCPG
GK
P06718 Mi5.1 precursor T superfamily Conus miles
MCCLPVFIILLLLIPSASS
VDVQPLTKDDVPLASFLANARR
TLQSLWMTRR
CCPKKPYCCPG
GK
P06104 Mi5.2 precursor T superfamily Conus miles
MLCLPVFIILLLLIPSASS
VDVQPLTKDDVPLASFLDDARR
TLQSLWMTRR
CCPGNFACC
GK
P06102 Mi5.2 precursor T superfamily Conus miles
MRCLPVFIILLLLIPSASS
VDVQPLTKDDVPLASFLDDARR
TLQSLWMTRR
CCPGNFACC
GK
P00854 Mi5.2 precursor T superfamily Conus miles
MRCVPVFIILLLLIPSASS
VDVQPLTRDDVPLASFLDDARR
TLRSPWMTRR
CCPGNFACC
GK
P06192 Mr036 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RLKTKDDMPLPSSHANIKR
TLQNASEQTLLPRLGIVLRV
G
P06193 Mr038 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RLKTKDDMPLPSSHANIKR
TLQMLRNK
RCCPGWELCCEWDDGCK
GK
P05476 Mr080 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RLKTKDDMPLPSSHANIKR
TLQMLRNKR
STIPSLGSEWDDGW
P05477 Mr081 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RLKTKDDMPLPSSHANIKR
TLQMLGTNAAAQAGNCAASGMMGGKGK
P05478 Mr082 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RLKTKDDMPLPSSHANIKR
TLQMLRTNAAAQAGNCAASGMMGGKGK
P05479 Mr083 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RLKTKDDMPLPSSHANIKR
TL
QMLRTNAAAQAGNCAASGMMGGKENDLR
P05480 Mr086 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RLKTKDDMPLPSSHANIKR
TLTNASEQTLLPRLGIVLRVG
P05481 Mr087 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
QLKTKDDVPLASFHANVKR
TLQKLLNKTLLPNSATVL
P05482 Mr088 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
QLKTKDDVPLASFHANVKR
TLTKAFEQTLLPNSATVL
P05483 Mr10.2 precursor T superfamily Conus marmoreus
MRCLLVFVILLQLTASAPGVDG
RPKTEDDVSLSSVSDNAKS
ILQGLLDKR
ACCVYKICYPC
P00855 Mr5.1a precursor T superfamily Conus marmoreus
MRCVPVFVILLLLIASAPS
VDARLKTKDDMPLPSSHANIKR
TLQIHRNKR
CCPGWELCCEWDEW
P00856 Mr5.1b precursor T superfamily Conus marmoreus
MRCVPVFVILLLLIASAPS
VDARLKTKDDMPLPSSHANIKR
TLQMLRNKR
CCPGWELCCEWDDGW
P05473 Mr5.1b precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RLKTKDDMPLPSSHANIKR
TLQMLRNKR
CCPGWELCCEWDDGW
P00859 Mr5.4a precursor T superfamily Conus marmoreus
MRCVPVFVILLLLIASAPS
VDVQLKTKDDVPLASFHANVKR
TLQILLNKR
CCQVMPQCCEWN
P05469 Mr5.4b precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
QLKTKDDVPLASFHANVKR
TLQKLLNKR
CCQIVPQCCEWN
P00877 Mr5.4b precursor T superfamily Conus marmoreus
ILLLLIASAPSVDA
QLKTKDDVPLASFHANVKRTLQKLLNK
R
CCQIVPQCCEWN
P02961 Mr5.5 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RPKTKDDMPLASFHDNAKR
ILQILQDR
NGCCRAGDCCSRFEIKENDF
G
P02963 Mr5.6 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RPKTKDDMPLASFHDNAKR
ILQILQDR
NGCCRAGDCCS
P05124 Mr5.7 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RLKTKDMPLPSSHANIKRT
LQIHRNKR
CCPGWELCCEWDDWW
P05470 Mr5.8 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
QLKTKDDVPLASFHANVKR
TLQKLLNK
RCCQIVPQCCEWVSD
P05474 Mr5.9 precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RLKTKDDMPLPSSHANIKR
TLQMLRNKR
CCPGWELCCEWDDGCKGNDL
R
P05485 MrIA precursor T superfamily Conus marmoreus
MRCLPVLIILLLLTASAPG
VVVLPRTEDDVPMSSVYGNGKS
ILRGILR
NGVCCGYKLCHPC
P01739 MrIA precursor T superfamily Conus marmoreus
MRCLPVLIILLLLTASAPG
VVVLPKTEDDVPMSSVYGNGKS
ILRGILR
NGVCCGYKLCHPC
P01714 MrVA precursor T superfamily Conus marmoreus
MRCLPVFVILLLLIASAPSVDA
RPKTKDDMPLASFHDNAKR
ILQILQDR
NACCIVRQCC
P00662 Pn-0111 precursor T superfamily Conus pennaceus
MRCLPVFIVLLLLIVSAPG
FDARPKTEDDVPLSSFHDDLQR
TVRTLLDIR
MCCLGTSGCCPW
G
P00658 Pn-0111 precursor T superfamily Conus pennaceus
MHCLSVFVILLLLTASAPSVDA
QPKTEDDVPLSSFHDDLQR
TVRTLLDIR
MCCLGTSGCCPW
G
P00641 Pn-014 precursor T superfamily Conus pennaceus
MRCLPVFVILLLLIASAPSVDA
RPKTKDDIPLVSFQDHAKR
ILQTFESR
YDCCKTFECCHW
G
P00663 Pn-B01121 precursor T superfamily Conus pennaceus
MCCLPVFVILLLLIASAPSVDA
LPKTKDDMSLASFHDNAKR
TLQILSNKR
YCCVYDYSCCLSW
G
P00665 Pn-B01122 precursor T superfamily Conus pennaceus
MRCLPVFVILLLLIASAPSVDA
RPKTKDDIPLVSFQDNAKR
ALQILSNKR
YCCYFDYSCCLYLR
P00670 Pn-B01411 precursor T superfamily Conus pennaceus
MRCFPVFIILLLLMASAPSFDA
RPKTEDDVPLSSFRDNLKR
TLRTLLDPRR
CCYETPGCCVI
G
P00656 Pn-B0151 precursor T superfamily Conus pennaceus
MRCLPVFVILLLLIASTPSVDA
LQKTKDDMPLASFHDNVKR
ILQTLSNKR
SCCPTILSCCFV
P00647 Pn-B02 precursor T superfamily Conus pennaceus
MRCLPVFIILLLLIASAPS
FDALPKTEDNVPLSSFHDNLKR
TRRIHLNIR
ECCSDGWCCPA
G
P00667 Pn10.1 precursor T superfamily Conus pennaceus
MRCLPVFVILLLLTASGPSVDA
KVHLKTKGDGPLSSFRDNA
KSTLQRLQDK
STCCGYRMCVPC
G
P00642 Pn5.1 precursor T superfamily Conus pennaceus
MRCLPVFVILLLLIASTPSVNA
RPKTKDLASFHDNAKRTQH
IFWSKR
NCCIYENWCCEWI
P00677 Pn5.2 precursor T superfamily Conus pennaceus
MLCLPVFIILLLLASPAAS
NPLEKRIQSDLIRAALEDADTK
NDPR
LLDYVTGACCAGLNFVCC
GKK
P00668 PnMRCL-012 precursor T superfamily Conus pennaceus
MHCLSVFVILLLLTASAPSVDA
QPKTEDGVLLSSFRDNAER
TLQKLWNHAR
DWCDPCPW
G
P02789 Pu5.1 precursor T superfamily Conus pulicarius
MRCVPVFVILLLLIASTPSVDA
RPNPKDDVPLASFHEDANG
ILQMLWKKGR
SCCPSPTSCCPW
GKRK
P05565 Pu5.10 precursor T superfamily Conus pulicarius
MLCLPVFIILLLLASPAAS
NPLETRIQSDLIRAALEDADMK
NRKRLFLSLR
GLNAIFSNLGDLGNLVSSVCCQSLLRVCCPE
D
P02791 Pu5.2 precursor T superfamily Conus pulicarius
MRCVPVFVILLLLIASTPSVDA
RPNPKDDVPLASFHGADNA
NRILRTLWNLR
GCCEDKTCCFI
G
P02793 Pu5.3 precursor T superfamily Conus pulicarius
MRCVPVFVILLLLIASTPSVDA
TQKTKDDMSLASFHDNAKR
ILQTLRNTR
SCCPEEPCCFW
R
P02795 Pu5.4 precursor T superfamily Conus pulicarius
MRCVPVFVILLLLIASTPSVDA
TQKTKDDMSLASFHDNAKR
FLQTLRNTR
SCCPEEITCCPW
G
P02797 Pu5.5 precursor T superfamily Conus pulicarius
MRCVPVFIILLVLIASAPSVDA
RPQTKDDALASFRDSIKRH
LQTLLDAR
ECCPQSPPCCHYYYYGSW
K
P02799 Pu5.6 precursor T superfamily Conus pulicarius
MRCVPVFVILLLLIASAAS
IDAQQKTKDDAPLTSLNDNALQ
QHWNKR
CCPRKIWCCMIP
R
P05562 Pu5.8 precursor T superfamily Conus pulicarius
MLCLPVFIILLLLASPAAS
NPLETRIQSDLIRAALEDADMN
R
KGFLSSIVGNLGTVGNLVCSVCCQITKSCCPED
P01733 PVA precursor T superfamily Conus purpurascens
MRCLPVFVILLLLIPSAPC
VDAHPKTKDDMPLASFHDNAKG
TLQRFWKKR
GCCPKQMRCCTL
G
P02955 Qc5.1 precursor T superfamily Conus quercinus
MRCVPVFIILLLLSPSAPSVDA
HPMTKDDVPQASFHDDAKR
TLQVPWMKR
GCCARLTCCV
GR
P02968 Qc5.2 precursor T superfamily Conus quercinus
MRCVPVFIILLLLSPSAPSVDA
HPMTKDDVPQASLHDDAKR
TLQVPWMKR
GCCAMLTCCV
GR
P06118 Qc5.3 precursor T superfamily Conus quercinus
MLCLPVFIILLLLVSPAAT
LRVQSKLERFLTQQSPRDFAKK
VMQLRYYNWIDCCFDGDCCN
P06119 Qc5.4 precursor T superfamily Conus quercinus
MLCLPVFIILLLLVSPAAT
LRVQSKLERFLTQQSPRDFAKS
IMQLR
HDNWIDCCHDGDCC
P06120 Rt5.1 precursor T superfamily Conus rattus
MLCLPVFIILLLLVSPAAT
LPVGSELQRDLTHESPKDLGMR
TDYLPFR
DVGDDCCSDNVGTCC
K
P06121 Rt5.2 precursor T superfamily Conus rattus
MLCLPVFIILLLLIPSASS
VDVQPLTKDDVPLASYNDNARR
TLQSLSMARICCSRKLWCCGIPF
P06086 S10.1 precursor T superfamily Conus striatus (Striated cone)
MRCLPVFVILLLLIASAPSVDA
QLKTKDDVPLSSFRGHAKS
TLRRLQDK
QTCCGYRMCIPC
G
P06098 S5.1 precursor T superfamily Conus striatus (Striated cone)
MRCLPVFVILLLLIASAPSVDA
QPKTKDDVPLPHLHDNIQN
TLQTLRKK
VCCRPMQDCCS
GK
P06099 S5.2 precursor T superfamily Conus striatus (Striated cone)
MRCLPVFIILLLLIASAPC
FDARTKTDDDVPLSPLRDNLKR
TIRTRLNIR
ECCEDGWCCTAAPLT
GR
P06100 S5.3 precursor T superfamily Conus striatus (Striated cone)
MRCFPVFVILLLLIASAPSVDA
RPKTKDGMPLASFHDNATR
NLQILCCKHTPACCT
GK
P03698 Sr5.4 precursor T superfamily Conus spurius
MRCLPVFVILLLLIASAPSVDA
QLKTKDDVPLASFHDNAKG
TQHKR
IINWCCLVFYQCC
P03697 Sr5.5 precursor T superfamily Conus spurius
MRCLPVFVILLLLIASAP
SVDDNAKGTQHKR
IINWCCLTFY
QCC
P03696 Sr5.6 precursor T superfamily Conus spurius
MRCLPVFVILLLLIASASSVDA
QLKTKDDVPLTSVHDNAKG
TQHRR
IMAGCCPRFYQCCYP
G
P03781 Sr5.7 precursor T superfamily Conus spurius
MRCLPVFVILLLLIASAPSVDA
QLKTKDDVPLASFHDNAKG
TQHKR
IINWCCLIFYQCCL
RR
P03695 Sr5.8 precursor T superfamily Conus spurius
MRCLPVFVILLLLIASASS
VDDNAKGTQHRR
IMAGCCPRFY
QCCYP
G
P03699 SrVA precursor T superfamily Conus spurius
MRCLPVFVILLLLIASAP
SVDDNAKGTQHKR
IINWCCLIFY
QCC
P03782 SrVA precursor T superfamily Conus spurius
MRCLPVLVILLLLIASAPSVDA
QLKTKDDVPLASFHDNAKG
TQHKR
IINWCCLIFYQCC
P03700 SrVA precursor T superfamily Conus spurius
MRCLPVFVILLLLIASAPSVDA
QLKTKDDVPLASFHDNAKG
TQHKR
IINWCCLIFYQCC
P01673 TeA31 precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCLPVFVILLLLIASVPSDA
VQLKTKDDMPLPSFNGNARR
TPRMLSNKR
ICCYPNVWCCD
P01682 TeAr151 precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCLPVFVVLLLLIASAPSVDA
QPKTKDDVPLAPLHDNIQN
TLQTLRKK
VCCRPMQDCCS
GK
P01683 TeAr154 precursor T superfamily Conus textile (Cloth-of-gold cone)
MHCLPVFVILLLLTASGLS
VDARPKTEDDVPLSSFRDNTKS
TLQRLLKR
VNCCPIDESCCS
P01678 TeAr193 precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCLPVFVILLLLIASAPSVDA
QPKTKDDIPQASFLDNAKR
YLQVLESKR
NCCRRQICCGRT
K
P06105 Tr5.1 precursor T superfamily Conus terebra
MRCLPVFIILLLLILPAPS
ADVQPKTKDHVHLASFLDSAKR
TVRGHCCPYYPQCCPS
G
P06106 Tr5.2 precursor T superfamily Conus terebra
MRCLPVFIILLLLIPSAPS
TDVQPKTKDDVPLASFRDSVKR
ILQRQCCPTISECCRV
G
P06107 Tr5.3 precursor T superfamily Conus terebra
MLCLPVFIILLLLVSPAAP
NPSETNLQSDFTLADPRDADVK
NR
GILELAKTVCCSATGISICC
P06108 Tr5.4 precursor T superfamily Conus terebra
MLCLPVFIILLLLASPAAP
TPFETNLQSDLTRAGPRDADMK
SMR
GIFSTLCCGVGINSCC
P06109 Tr5.5 precursor T superfamily Conus terebra
MLCLPVFIILLLLIPSASS
VDVQPLTKDDVPLASFLANARR
TLQSLWMTRR
CCPKKPYCCPG
GK
P06110 Tr5.6 precursor T superfamily Conus terebra
MLCLPVFIILLLLVSPAAT
LRVQSKLERFLTQQSPRDFAKK
VMQLRYYNWIDCCFDGACCN
P00673 Ts-011 precursor T superfamily Conus tessulatus
MHCLPVLVILLLLIASTPSVDA
RPKTKDDVPPASFHGADDA
NRILQTLWNLR
GCCEDKTCCFI
G
P00674 Ts-011 precursor T superfamily Conus tessulatus
MHCLPVLVILLLLIASTPSVDA
RPKTKDDVPLASFHGADNA
NRILRTLWNLR
GCCEDKTCCFI
G
P03835 Ts-011 precursor T superfamily Conus tessulatus
MHCLPVPVILLLLIASTPSVDA
RPKTKDDVPPASFHGADNA
NRILRTLWNLR
GCCEDKTCCFI
G
P00660 Ts-03 precursor T superfamily Conus tessulatus
MRCLPVFIILLLLIPSAAS
VAQPKTKDDVALASFYDNAKRT
LQRHWAK
SLCCPEDAWCC
P00661 Ts5.1 precursor T superfamily Conus tessulatus
MRCLPVFIILLLLIPSAASA
AQPETKDDAALASFYDNAKR
T
LQRHWAKSLCCPEDAWCCSHDE
GK
P00672 Ts5.2 precursor T superfamily Conus tessulatus
MHCLPVLVILLLLIASTPSVDA
RPNPKDDVPLASFHGAVNA
KRYLRTLWNSR
DCCDPKEPCCFI
G
P00675 Ts5.3 precursor T superfamily Conus tessulatus
MLCLPVFIILLLLASPAAP
NPLERRIQSDLIRTALEDADMK
TPKG
VLSGIMSNLGTVGNMVGGFCCTVYSGCCSE
K
P00682 Ts5.4 precursor T superfamily Conus tessulatus
MLCLPVFIILLLLASPAAP
NPLETRIQRDLIRAALEDADMK
TNER
FLEGVISTIKDFAGKVCCSVSVNFCCPTA
P06117 Ts5.7 precursor T superfamily Conus tessulatus
MLCLPVFIILLLLASPAAP
NPFETKLQSDSTRADAD.ETDK
NLDAVR
KAICCDVFPGTDCCM
G
P00684 TsMLCL-02 precursor T superfamily Conus tessulatus
MLCLPVFIILLLLASPAAP
NPLERRIQSDLIRAALEDADMK
TEKGILSSIMGTLGKIVGLAP
P00648 Tx-D0111 precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCLPVFVILLLLIASTPS
DTVPLKTKDDMPQASFHGNARR
TLQMLSKK
QCCWYFDISCCITV
P00650 Tx-D021 precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCLPVFVILLLLIASTPSVDA
RAKTRDDMSLASFHDDAKR
ILQILQDR
SGCCVIDSNCC
G
P01730 Tx5.1 precursor T superfamily Conus textile (Cloth-of-gold cone)
MCCLPVFVILLLLIASAPSVDA
QPKTKDDVPLAPLHDNAKS
ALQHLNQR
CCQTFYWCCVQGK
P06093 Tx5.11 precursor T superfamily Conus textile (Cloth-of-gold cone)
MLCLPVFIIVLLLIASAPSFDA
RSKTKDDVPLSSFRDNAKR
ILQTLQTK
RDCCKGNPGCCGWD
P06095 Tx5.13 precursor T superfamily Conus textile (Cloth-of-gold cone)
MLCLPVFIILLLLASPAAP
MPSETNLQSDFTLADPRDADVK
NR
GILELAKTVCCSATGISICC
P06096 Tx5.14 precursor T superfamily Conus textile (Cloth-of-gold cone)
MLCLPVFIILLLLASPAAP
MPSETNLQSDFTLADPRDADVK
NR
GIFALAKSVCCTAAKLSFCC
P06097 Tx5.15 precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCLPVIVILLLLIASAPSVDA
QPKTKDDIPQASFLDNAKR
YLQVLESK
RNCCRRQICCGRNH
P06094 Tx5b precursor T superfamily Conus textile (Cloth-of-gold cone)
MLCLPVFIILLLLIASTPSIDA
RPKTKDDMPLASFNDNAKR
ILQILSR
KPCCSIHDSSCCGL
G
P00646 TxMRCL-03 precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCLPVFVILLLLIASAPSVDA
QPKTKDDIPQASFLDNAKR
YLQVLESKR
NCCRRQICCGRPS
P00657 TxMRCL-04 precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCLPVFVILLLLIASTPSVDA
QLKTKDDMSLASFHDNVKR
ILQIR
TTEECCPFIVGCCS
R
P00644 TxMRCL-D012 precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCLPVFVILLLLIASTPS
DTVPLKTKDDMPQASFHGNARR
TLQMLSKK
QCCWYFDISCCLWP
P02959 TxVA precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCFPVFIILLLLIASAPC
FDARTKTDDDVPLSSLRDNLKR
TIRTRLNIR
GCCEDGWCCTAAP
LTGR
P00649 TxVA precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCFPVFIILLLLIASAPCFDA
RTKTDDDVPLSPLRDNLKR
TIRTRLNIR
ECCEDGWCCTAAP
LTGR
P00645 TxVA precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCFPVFIILLLLIASAPC
FDARTKTDDDVPLSSLRDNLKR
TIRTRLNIR
ECCEDGWCCTAAP
LTGR
P00643 TxXIIIA precursor T superfamily Conus textile (Cloth-of-gold cone)
MRCLPVFVILLLLIASVPSVDA
ELKAKDDMPQASFHDNAER
DQQKK
TSDCCFYHNCCC
P06297 Vc10.1 precursor T superfamily Conus victoriae
MRCLPVFVILLLLTASAPSVDA
RLKTKDDVPLSSFRDNAKS
TLRRLQDK
QTCCGRTMCVPC
G
P06296 Vc13.1 precursor T superfamily Conus victoriae
MRCLPVFVILLLLIASTPNVDA
QLKTKDDMPQASFHDNAKQ
DQQIRLR
TSDCCFYHNCCC
P06312 Vc5.10 precursor T superfamily Conus victoriae
MRCLPIFVILLLLITSTPSVDA
RLKAKDNMPLASFHDNAKR
TLQTR
LINTRCCPGQPCCRI
G
P06311 Vc5.11 precursor T superfamily Conus victoriae
MRCLPIFVILLLLITSTPSVDA
RLKAKDNMPLASFHDNAKR
TLQTR
LINTRCCPGQPCCRM
G
P06310 Vc5.12 precursor T superfamily Conus victoriae
MRCLPVFVILLLLIASAPSVDA
QPKTKDDVPLAPLHDNAKS
ALQHLNQR
CCQAFYWCCY
P06309 Vc5.13 precursor T superfamily Conus victoriae
MRCFPVFIILLLLIASAPS
FDARSKTEDDVPLSSFRGNGKR
ILRNLR
DNKTVCCKRGTLCCFV
G
P06308 Vc5.14 precursor T superfamily Conus victoriae
MHCLPVFVILLLLTASAPSVDA
QPKTKDDVFLSSFDDNAKS
TLRRLQYK
QTCCGFKFFCC
R
P06307 Vc5.15 precursor T superfamily Conus victoriae
MRCLPVFVFLLLLIASTPRVDA
RRKTKDMPLAPFHENAKRT
LHILLNK
RDCCLIDEWCCEVDEEFGY
K
P06306 Vc5.16 precursor T superfamily Conus victoriae
MRCLPVFVILLLLIASTPRVDA
RRKTKDNMPLAPFQENAKS
TLQLLLNK
RQCCPTFSECCEMEEEFGL
K
P06305 Vc5.17 precursor T superfamily Conus victoriae
MRCLPVFVILLLLIASAPSVDA
RMEPKDMPLASSQANVKRI
QQIRQNKR
ICCPLMELCCEW
P06304 Vc5.18 precursor T superfamily Conus victoriae
MRCLPVFVILLLLIASIPSDA
VQLKTKDDMPLASFHGNGRR
TQRMLSNKR
FCCFPEHWCCEW
P06303 Vc5.19 precursor T superfamily Conus victoriae
MRCLPIFVILLLLIASIPSDA
VQLKTKDDMPLASFHGNGRR
TLRMLLNK
RLCCITEEWCCQWW
P06302 Vc5.20 precursor T superfamily Conus victoriae
MRCLPIFIILLLLIASAPSVDA
QPKTKDDVSLASLHAQPKT
KDDVSLASLHDNIKSTLQTLWNK
RCCPPVIWCC
G
P06301 Vc5.21 precursor T superfamily Conus victoriae
MRCLPVLVILLLLTASAPSVDA
LPKPKDDVPLAPLHDNAKS
ILQSLWNK
RDCCTNLLPCCY
P06300 Vc5.22 precursor T superfamily Conus victoriae
MLCLPLFIILLLLASPAVP
EPLETSLQRNLIGAALRDAGMK
SDNIFLR
GICCSKHPPCCSQFQ
P06299 Vc5.23 precursor T superfamily Conus victoriae
MRCLPIFVILLLLIASTPSVDA
RPKTKDDMPLASFNDNAKR
ILQLLLRK
RCCSIHDNSCCGL
G
P06298 Vc5.24 precursor T superfamily Conus victoriae
MRCLPIFVILLLLIASTPSVDA
RPKTKDDMPLASFNDNAKR
ILQLLLR
QPCCSIHDISCCGL
G
P01717 Vc5.3 precursor T superfamily Conus victoriae
VILLLLTASAPSVDA
RPKTEDVPLSSFRDNTKSTLQRLLKR
VNCCGIDESCCS
P06317 Vc5.5 precursor T superfamily Conus victoriae
MRCLPIFVILLLLITSTPSVDA
RLKAKDNMPLASFHDNAKR
TLQTR
LINTRCCPAQPCCRM
G
P06316 Vc5.6 precursor T superfamily Conus victoriae
MRCFPVFIILLLLIASAPS
FDARSKTEDDVPLSSFRGNGKR
ILRNLR
DNETVCCERGALCCFV
G
P06315 Vc5.7 precursor T superfamily Conus victoriae
MRCFPVFIILLLLIASAPC
FDARTKTDDDVPLSSLRDNQKR
TIRTRLNIR
ECCEDGWCCTAAPLTAP
P06314 Vc5.8 precursor T superfamily Conus victoriae
MRCFPVFVFLLLLIASTPRVDA
RRKTKENMPLAHFHDNAKR
TLQIFSNILECCYSDEWCCEVDEELGL
KR
P06313 Vc5.9 precursor T superfamily Conus victoriae
MRCLPVFVILLLLIASAPSVDA
QPKTKDDIPQQASFQDNAK
RYLQVLESK
RNCCRLQICCGRT
K
P01549 VcVA precursor T superfamily Conus victoriae
VILLLITSTPSVDA
RLKAKDNMPLASFHDNAKRTLQTRLIN
TR
CCPGKPCCRI
G
P01548 VcVB precursor T superfamily Conus victoriae
VILLLLIASAPSVDA
QPKTKDDVPLAPLHDNAKSALQHLNQ
R
CCQTFYWCCGQ
GK
P01522 VcVC precursor T superfamily Conus victoriae
VILLLLIASIPSDA
VQLKTKDDMPLASFHGNARRTLQMLSN
KR
ICCYPNEWCCD
P02811 Vi5.1a precursor T superfamily Conus virgo
MRCVPVFIILLLLIPSAPSADA
QPKTKDDVPLASYHDNAER
TLQRLWNQR
HCCPIDLPCCPP
G
P02813 Vi5.1b precursor T superfamily Conus virgo
MLCVPVFIILFIIIPFAPTSES
QPKTKEEVAKASVHDNAER
TLQRLWNQS
HCCPIDLQCCPP
G
P02833 ViVA precursor T superfamily Conus virgo
MRCVPVFIILLLLIPSASS
AAVQPKTEKDDVPLASVHDSAL
RILSR
QCCITIPECCRI
G
P02834 ViVB precursor T superfamily Conus virgo
MRCVPVFIILLLLIPSAPSAAV
QPKTEKDDVPLASFHDSAM
RILSR
QCCPTIPECCRV
G
P00664 Vn-05 precursor T superfamily Conus ventricosus
MRCLPVFIILLVLSASAPSVDA
RPKNEDDVSLASFHDNAQR
TLQRLLNKR
SCCPNNPACCH
P00651 Vn5.1 precursor T superfamily Conus ventricosus
MRCLPVFVILLLLIASAPGVDA
QPKTKYDVPLASRHDFAKK
TPKRLSKPR
DCCRRNFLCC
P00652 Vn5.1 precursor T superfamily Conus ventricosus
MRCLPVFVILLLLIASAPG
VDDFAKKTPKRLSKPR
DCCRRN
FLCC
P00653 Vn5.2 precursor T superfamily Conus ventricosus
MRCLPVFVILLLLIASAPGVDA
QPKTKYDVPLASRHDFAKK
TPKRLSKPR
DCCLRHFLCCV
P00654 Vn5.3 precursor T superfamily Conus ventricosus
MRCLPVFVILLLLIASAPG
VDVQPKTKYYVPRASRRDFAKK
TPKRLSKLR
GCCPRSFLCC
R
P00655 Vn5.3 precursor T superfamily Conus ventricosus
MHCLPVFVILLLLIASAPG
VDVQPKTKNFMTRASLRDFAKK
TPKRLSKLR
GCCPRSFLCC
R
P00659 Vn5.4 precursor T superfamily Conus ventricosus
MRCLPVFVILLLLIASAPSVDA
RPKTKDDVPLASFHGNAER
TLLNILRDGDNCCIDKQGCCPW
G
P00680 Vn5.5 precursor T superfamily Conus ventricosus
MLCLPVFIILLLLASPAAP
NPLEKRIQSDLIRAALEDADMK
TDER
EIVNIIDSISDVAKQICCEITVQCCVLDEE
P00681 Vn5.6 precursor T superfamily Conus ventricosus
MLCLPVFIILLLLASPAAP
NPLEKRIQSDLIRAALEDADMK
TGER
EILNIIDSISDVAKQICCQITVDCCVLDEE
P00686 VnMLCL-01 precursor T superfamily Conus ventricosus
MLCLPVFIILLLLASPAAP
NPLQTRIQSNLIRAGPEDANMK
TDKRVIISGLLSSILVPLVNAIKG
P00773 VnMLCL-031 T superfamily Conus ventricosus
MLCLP.FIILLLLASPAAP
NPLQTR.QSNLIRAGPEDANIK
T.KRVIISGL..SILVPLIDAIIG
P00690 VnMLCL-033 T superfamily Conus ventricosus
MLCLPVFIILLLLASPAAP
NPLQTRIQSNLIRAGPEDANIK
TDKRVISGLLASILVPLIDAIIG
P00685 VnMLCL-041 precursor T superfamily Conus ventricosus
MLCLPVFIILLLLASPAAP
NPLQTRIQSNLIRAGPEDANIK
TDKRVIISGLLASILVPLIDAIKG
P00688 VnMLCL-042 T superfamily Conus ventricosus
MLCLPVFIILLLLASPAAP
NPLQTRIQSNLIRAGPEDANMK
TDKRVISGLLAGILVPLIDAIMG
P00687 VnMLCL-05 precursor T superfamily Conus ventricosus
MLCLPVFIILLLLASPAAP
NPLQTRIQSNLIRAGPEDANIK
TDKRIFAGLLASILKPIIDAAKG
P06125 Vr5.1 precursor T superfamily Conus varius
MLCLPVFIILLLLVSPAAP
MPSETNLQSDFTLADPRDADVK
NR
GILELAKTVCCSATGISICC
P06126 Vr5.2 precursor T superfamily Conus varius
MLCLPVFIILLLLVSPAAP
MPSETNLQSDSTLADPRDAEMK
NR
GIISLAKSLCCTGIGISFCC
P06127 Vr5.3 precursor T superfamily Conus varius
MLCLPVFIILLLLASPAAP
MPSETNLQSDFTLADPRDADVK
NR
GIFALAKSVCCTAAKLSFCC
P06128 Vr5.4 precursor T superfamily Conus varius
MLCLPVFIILLLLASPAAP
MPSETNLQSDFTLADPRDADVK
NR
GIHELAKSVCCTATGISICC
P06111 Vx5.1 precursor T superfamily Conus vexillum
MRCLPVFIILLLLILPAPS
ADVQPKTKDHVHLASFLDSAKR
TVRGHCCPYYPQCCPS
G
P06112 Vx5.2 precursor T superfamily Conus vexillum
MLCLPVFIIHLLLVSPAATLA
VESELQRDLTHESPKDFGMR
TEHLPVK
RVGDDCCVGNVGTCCS