Alpha Conotoxin Peptides (N01061) Nucleic Acid Card

General Information
Name Alpha Conotoxin Peptides
Organism Conus geographus (Geography cone)
Organism Diet piscivorous
Organism Clade II
Organism Region Indo-Pacific
Notes

Sequence
atgttcaccgtgtttctgttggtggtcttggcaaccactg
tcgtttccttcccttcagaacgtgcatctgatggcaggga
tgacacagccaaagacgaagggtctgacatggagaaattg
gtcgagaaaaaagaatgttgcaatcctgcctgtggcagac
actacagttgtggacgc
tgatgctccaggaccctctgaac
cacggacgtgccgccctctgcctgacctgcttcactgtcc
gtctctttgtgccactagaactgaacagctcgatccacta
gactaccacgttacctccgtgttctaaaactacttggttt
agattgcctttaatttctagtcatacttcctgttattacg
tcgtccaaaattgaaacaagaacatgaggggtgtcagctc
aaacaaaatcaggcaatgacaaggaaaatgtctccgatcg
atccgaaaactgtcacccgtcactctcttaaccagtttta
gaactgattaccactagagcttttgtaccacatcaaatca
ggtctatgtgtgatgtttcttttgcaaaatttaatttttg
agaaaaaaagctcaaaatgtgggaagtgcttttgattttc
tgacaacttgtgatcatgtccgttttcagtgagtctaatt
gcaacctctgtgtgattttcttcacctgttaagcaacgca
aagaggttgtccataaccaggaaagcaacagacaaagaaa
tgcttgagaatttcaggttatagataaggtaaggaaaaaa
aggagagctatgggaaatgatgaaaacaacagataaaata
aattgaacagtacctacttgtttcatggttgatttttttt
tctctgaataatctctgtggacactaatggcagtctctcc
tcaccccacgccattagtaagcttattttttctttcttta
tccaagatttgctgaacatatttagcctagatatagacat
tgctacatatataatctgacaataaactttcatgggcacc
aatt
Sequence translation MFTVFLLVVLATTVVSFPSERASDGRDDTAKDEGSDMEKL
VEKKECCNPACGRHYSCGR

References
Olivera,B.M., Layer,R.T., Watkins,M., Hillyard,D.R., Mcintosh,M.J., Jones,R.M. and Schoenfeld,R. (2003) Alpha Conotoxin Peptides JP 2003525582-A 3 02-SEP-2003

Internal links
Proteins Encoded GI precursor

External links
Ncbi
GenBank BD394961

Tools