Contulakin-G, its analogues and utilization thereof (N01211) Nucleic Acid Card

General Information
Name Contulakin-G, its analogues and utilization thereof
Organism Conus geographus (Geography cone)
Organism Diet piscivorous
Organism Clade II
Organism Region Indo-Pacific
Notes

Sequence
atgcagacggcctactgggtgatggtgatgatgatggtgt
ggattgcagcccctctgtctgaaggtggtaaactgaacga
tgtaattcggggtttggtgccagacgacataaccccacag
ctcatgttgggaagtctgatttcccgtcgtcaatcggaag
agggtggttcaaatgcaaccaagaaaccctatattctaag
ggccagcgaccaggttgcatctgggccatag
Sequence translation MQTAYWVMVMMMVWIAAPLSEGGKLNDVIRGLVPDDITPQ
LMLGSLISRRQSEEGGSNATKKPYILRASDQVASGP-

References
Craig,G.A., Griffen,D., Olivera,B.M., Watkins,M., Hillyard,D.R., Imperial,J., Cruz,L.J., Wagstaff,J.D., Layer,R.T., Jones,R.M. and Mccabe,T.R. (2002) Contulakin-G, its analogues and utilization thereof Patent: JP 2002527093-A 2 27-AUG-2002

Internal links
Proteins Encoded contulakin-G precursor

External links
Ncbi
GenBank BD237281

Tools