Conus aristophanes isolate Ar2 four-loop conotoxin mRNA, partialcds. (N01232) Nucleic Acid Card

General Information
Name Conus aristophanes isolate Ar2 four-loop conotoxin mRNA, partialcds.
Organism Conus aristophanes
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
c
gtgatgatcgtcgccgtgctgttcctgacggcctgtcaa
ctcactacagctgagacttcctccagaggtaagcagaagc
atcgtgctctgaggtcaactgacaaaaactccaggttgac
caagcgttgcacgcctcccagtggatactgttatcatcct
tattactgctgcagcagagcttgcaatctcacgagaaaac
gatgtctg
tagtcctaaattccccttccgtgatctatcct
cttttg
Sequence translation VMIVAVLFLTACQLTTAETSSRGKQKHRALRSTDKNSRLT
KRCTPPSGYCYHPYYCCSRACNLTRKRCL

References
Duda,T.F. Jr. and Remigio,E.A. (2008) Variation and evolution of toxin gene expression patterns of six closely related venomous marine snails. Mol. Ecol. 17:3018-3032

Internal links
Proteins Encoded At6.2 precursor

External links
Ncbi
GenBank EF108277

Tools