Leo-O2, mRNA, partial sequence. (N01250) Nucleic Acid Card

General Information
Name Leo-O2, mRNA, partial sequence.
Organism Conus leopardus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
tgatccttggacggtgaacctgacttcacatttcttcagt
cttccttggcatcaccaagatcatcagcaga
atgaaattg
acgtgcgtgttgatcatcgccgtactgttcctgacggcct
gtcaactcgttacagctgattactccggagatgagcagca
gtaccgtgcaatgaggttgatagacgcaatgcggaatttc
ggagataccaggtcgtgcgggagacgaggtaaaccttgtc
cttgctgccgtggcttcaggtgcactggctcgttttgccg
gaagtggcaa
tagtctggcatctgatatttcccctctgtg
ctccaccttcttttgcctgattcatccttacgtatgtgtg
gtcatgaaccactcagtagctacacctctggtggctttag
aggacgtatatcaaaataaaaccacattgcaatgacaaaa
aaaaaaa
Sequence translation MKLTCVLIIAVLFLTACQLVTADYSGDEQQYRAMRLIDAM
RNFGDTRSCGRRGKPCPCCRGFRCTGSFCRKWQ

References
Remigio,E.A. and Duda,T.F. Jr. (2008) Evolution of ecological specialization and venom of a predatory marine gastropod. Mol. Ecol. 17:1156-1162

Internal links
Proteins Encoded Lp6.2 precursor

External links
Ncbi
GenBank EF467317

Tools