Conus ventricosus clone VnMKLT1-021 conotoxin scaffold VI/VII precursor, mRNA, complete cds (N00136) Nucleic Acid Card

General Information
Name Conus ventricosus clone VnMKLT1-021 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Organism Conus ventricosus
Organism Diet vermivorous
Organism Clade
Organism Region Eastern Atlantic and Mediterranean
Notes

Sequence
cccaaaacatcaccaag
atgaaactgacgtgcgtgatgat
cgttgctgtgctgttcttgaccgcctggacattcgtcacg
gctgatgaccccagagatggaccggatactgcagtaggat
ggcggaaacttttctcggaggcacgtgacgaaatgaagaa
ccgcgaagcctctaagttgaacgagcgaggctgcattgaa
gataaaaaatattgtggcatattaccgtttgcgaatagcg
gggtatgctgcagttacctttgtatatttgtctgcgtacc
caaggcgccg
tgatgtcttctgctcccctctgtgctaccc
ctggcttgatctttgattggcgcatgcccttcactggtta
tgaacccctctgatcctactctctgaagacctctggggtc
caacat
Sequence translation MKLTCVMIVAVLFLTAWTFVTADDPRDGPDTAVGWRKLFS
EARDEMKNREASKLNERGCIEDKKYCGILPFANSGVCCSY
LCIFVCVPKAP

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Vn6.12 precursor

External links
Ncbi
GenBank AF215036

Tools