Conus imperialis M superfamily conotoxin 3 precursor, mRNA,complete cds. (N01397) Nucleic Acid Card

General Information
Name Conus imperialis M superfamily conotoxin 3 precursor, mRNA,complete cds.
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
atgtctaaactgggagtcgtgttgttcacccttctacttc
tggtgcccctggtaacccctgaacgggatggaggtaaatg
gacgatgttggccaagaacaaaaaggcaatgaaacgtaac
ctgatggatttcataacaagaacttgcgatccttattact
gcaatgacggcaaggtatgctgccctgagtacccgacctg
tggcgactcaacgggaaagttaatatgtgtcagagtaaca
gac
tgatagtatctgatgaaaacatatcactgcgttgtgt
attgtgtacacaccagtgagccgagttttggttaggtctt
cttatatcacttttgccctggttttctctcttctcactcg
cgttttctcagaagcaaaaatttcctgtgctttttcgttt
acagagagtggttctgaaaactacttgtttgagaaaagga
tgaccactcaaacatcagctccagtgtcaaagatacatct
tcttgaaactgaaaacagtataatgcattcaaattttgtt
aaggcagattgctttgcaaattgtaaatatctagacttct
cttacaagtggttgagtgtacacacacacacacacacaca
cacacacacacacacacacacacacacacacacacacaca
cacacacacacacacacacaccatttgcacttactggcta
ttttaaatgggtttcttattctttaaagcagtattataag
atcaaggttattcgggaaaacgcatttcccattactttct
cataaacgaactccgcttgttttgaaataccacagagaaa
taaacttgcaacattagaaaaaaaaaa
Sequence translation MSKLGVVLFTLLLLVPLVTPERDGGKWTMLAKNKKAMKRN
LMDFITRTCDPYYCNDGKVCCPEYPTCGDSTGKLICVRVT
D

References

Internal links
Proteins Encoded Im6.7 precursor

External links
Ncbi
GenBank FJ237364

Tools