Sequence 239 from Patent EP1852440. (N01480) Nucleic Acid Card

General Information

Name	Sequence 239 from Patent EP1852440.
Organism	Conus regius
Organism Diet	vermivorous
Organism Clade	XVII
Organism Region	Eastern Pacific
Notes

Sequence

tctaatggaaggaatgccgcagccgacgccaaagcgtctc aacggatcgctccattcctcagggactattgctgtaggag acatgcctgtacgttgatttgtggt tgaagacgctgctgc tccaggaccctctgaaccacgacgt
Sequence translation	SNGRNAAADAKASQRIAPFLRDYCCRRHACTLICG

References

Watkins, M., Hillyard, D.R., McIntosh, M.J., Jones, R.M. and Olivera, B.M. (2007) Alpha-conotoxin peptides Patent: EP 1852440-A 07-NOV-2007; University of Utah Research Foundation (US);

Internal links

Proteins Encoded

Sequence 239 from Patent EP1852440.

External links

Ncbi
GenBank	FB300069

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Thursday 1 June 2023