Conus litteratus I-superfamily 11.2 mRNA, complete cds. (N01610) Nucleic Acid Card

General Information
Name Conus litteratus I-superfamily 11.2 mRNA, complete cds.
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgatgtttcgattgacgtcagtcagctgtttcctgctat
tcatcgttttcctgaatttggttgtgcttaccaatgcctg
catccctgaaggaacgtactgccaatttaatgctgattgc
tgtctatcacaatgctgttgggggagttgcggaaatccgt
gccgctttcctggaaagagggagaaactccaagaattctt
tcgacaacgt
tgatatgttgatagaggtctgctgctcttc
gtcgtaagtggcagataactcaagcctgacgtctctgttc
tttctccccgtcttcttcttcctacgcccctcccaccccc
tctccctcctcctccccgcaccatgctaataaatttgatg
ctgcagaaaaaaaaaaaa
Sequence translation MMFRLTSVSCFLLFIVFLNLVVLTNACIPEGTYCQFNADC
CLSQCCWGSCGNPCRFPGKREKLQEFFRQR

References
Liu,Z., Xu,N., Hu,J., Zhao,C., Yu,Z. and Dai,Q. (2009) Identification of novel I-superfamily conopeptides from several clades of Conus species found in the South China Sea. Peptides 30:1782-1787

Internal links
Proteins Encoded Lt11.2 precursor

External links
Ncbi
GenBank GQ180870

Tools