Mr2, mRNA, complete cds (N01647) Nucleic Acid Card

General Information
Name Mr2, mRNA, complete cds
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgtcaaaactgggagtcgtgctgctcatcttcgtggttc
ttttggctctgacatctcctcatcattatgggaatagatt
tgctggttaccaggcgaggcaaatgggcgtgcaacaaaga
aagaatgcgttggccaatgctctgagacgttcaggctgtg
gatacctgggagagccttgctgcgtcgctcccaaacgtgc
gtattgccatggggatcttgaatgcaacagcgtagcaatg
tgcgttaactaa
gacgcacagcagtctacgaacgtggaaa
gacccaatgtgtttccattattgtagaatttactcatttg
tttattcatatgtgcgttgcaatttgtttgcgtacaaatg
tcgcatttcgatgtttatggcaccttgtttacgtacacat
tgtgcatttcaatatttattgttattgttgcttttcaatt
tctctccaatgacgtgcagaatgtacaactagattgacag
tgtgcatggcacacattcaaaatcattacaataaagactc
tagccaaaaagcaaaaaaaaaaaa
Sequence translation MSKLGVVLLIFVVLLALTSPHHYGNRFAGYQARQMGVQQR
KNALANALRRSGCGYLGEPCCVAPKRAYCHGDLECNSVAM
CVN-

References

Internal links
Proteins Encoded Mr2 precursor

External links
Ncbi
GenBank GQ244485

Tools