Conus eburneus clone Eb5 M superfamily conotoxin mRNA, completecds. (N01648) Nucleic Acid Card

General Information
Name Conus eburneus clone Eb5 M superfamily conotoxin mRNA, completecds.
Organism Conus eburneus
Organism Diet generalist
Organism Clade
Organism Region
Notes

Sequence
atgtcaaaactgggagtcgtgctgctcatcttcgtggttc
ttttggctctgacatctcctcatcattatgggaatagatt
tgctggttaccaggcgaggcaaatgggcgtgcaacaaaga
aagaatgcgttggccaatgctgtgagacgttcaggctgtg
gatacctgggagagccttgctgcatatctcccaaacgtgc
gtattgccatggggatcttgaatgcaacaacgtagcaatg
tgcgttaactaa
gacgcacagcagtctacgaacgtggaaa
gacccagtgtgtttccattattgtagaatttactcatttg
tttattcatatgtgcgttgcaatttgtttgcgtacaattg
tcgcatttcgatgtttatggcaccttgtttacgtacacat
tgtgcatttcaatatttattgttattgttgcttttcaatt
tctctccaatgacgtgcagaatgtacaactagattgacag
tgtgcatggcacacattcaaaatcattacaataaagactc
tagccaaaaagcaaaaaaaaaaaa
Sequence translation MSKLGVVLLIFVVLLALTSPHHYGNRFAGYQARQMGVQQR
KNALANAVRRSGCGYLGEPCCISPKRAYCHGDLECNNVAM
CVN-

References

Internal links
Proteins Encoded Eu5 precursor

External links
Ncbi
GenBank GQ244484

Tools