Conus marmoreus conotoxin Mr12.8 mRNA, complete cds. (N01650) Nucleic Acid Card

General Information
Name Conus marmoreus conotoxin Mr12.8 mRNA, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgttcggtcatacgtcagtcagttttcttctgctctcca
tcgtggctcttggcatggtggcgacggttatttgctcgtg
tgactcggaattctcgagtgaattctgtgaacagccggaa
gaaaggatctgctcgtgctccactcatgtgtgctgtcatt
tgagttcaagcaaaggggatcagtgtatgacatggaatag
gtgcctctctgcgcaaacaggaaatcgcagatcaactcat
atgcaaaaaagattccttcgtatgccacgtgatcttgccg
actag
tctgtgtgacaagagagctgacaccaaatcctggg
gattcccttaccgaagttttgctgtccccccttttttccc
tcacctgttgagctgatcaaatagggactcccccaccatc
tatacatcgctgacagcaacaaacctgcaaaaccttcatg
tacctggttcatctttcattcggctccatttattattgat
ttcagtcttcttggttttcttcagctgtcagcggttcttg
tcttttttcagtacaaagatatttcttgaagtgtatactg
aagtttaaaaaaaaaaaa
Sequence translation MFGHTSVSFLLLSIVALGMVATVICSCDSEFSSEFCEQPE
ERICSCSTHVCCHLSSSKGDQCMTWNRCLSAQTGNRRSTH
MQKRFLRMPRDLAD-

References
Liu,Z., Yu,Z., Liu,N., Zhao,C., Hu,J. and Dai,Q. (2010) cDNA cloning of conotoxins with framework XII from several Conus species. Acta Biochim. Biophys. Sin. (Shanghai) 42:656-661

Internal links
Proteins Encoded Mr12.8 precursor

External links
Ncbi
GenBank GQ228842

Tools