Lv15a precursor, mRNA, complete cds (N01660) Nucleic Acid Card

General Information
Name Lv15a precursor, mRNA, complete cds
Organism Conus lividus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
ccttcatc
atggagaaacttacngtcctgattcttgttgc
cactgtcctgctgatgatccaggtcctggctcaaagtggc
ggagataaacatctgaagaggaggcccaaacaatacgcaa
ccaaacgtctctcggcactcatgagagggcaccgtcaatg
cacacctcagaatgtgcaatgtgaggaggacgacgaatgt
tgctcgaatcttgagtgcaaatgctctactgttccagatt
gcaattttcctaaatgtagaccataa
tgacctcatgccat
ctcatatcaatacatcagagccacaacc
Sequence translation MEKL?VLILVATVLLMIQVLAQSGGDKHLKRRPKQYATKR
LSALMRGHRQCTPQNVQCEEDDECCSNLECKCSTVPDCNF
PKCRP-

References

Internal links
Proteins Encoded Lv15a precursor

External links
Ncbi
GenBank GQ414739

Tools