Im12.10 mRNA, complete cds (N01666) Nucleic Acid Card

General Information
Name Im12.10 mRNA, complete cds
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
atgttcggtcatacgtcagtcagttttcttctgctctcca
tcatggctcttggcatggtggcgacggttatttgcttgtg
tgactcgtacatctcgagtgaactctgtgaacatccggaa
gaaacctgcttttgccccaatcatatgtgctgtccgttga
gtccatacagacaggatcagtgtatgtattgggaagcgtg
ccacatatttcgaaaaccagtgggtagcagatga
actcat
atgcaaaaaaaaaaa
Sequence translation MFGHTSVSFLLLSIMALGMVATVICLCDSYISSELCEHPE
ETCFCPNHMCCPLSPYRQDQCMYWEACHIFRKPVGSR-

References
Liu,Z., Yu,Z., Liu,N., Zhao,C., Hu,J. and Dai,Q. (2010) cDNA cloning of conotoxins with framework XII from several Conus species. Acta Biochim. Biophys. Sin. (Shanghai) 42:656-661

Internal links
Proteins Encoded Im12.10 precursor

External links
Ncbi
GenBank GQ228836

Tools