Conus circumcisus isolate Cr1.6 superfamily conotoxin gene, partial cds. (N01692) Nucleic Acid Card

General Information
Name Conus circumcisus isolate Cr1.6 superfamily conotoxin gene, partial cds.
Organism Conus circumcisus (circumcision cone)
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
gcatctgatggcaggaatgccgcagccgacgacaaagcgt
ctgacctggtcgctctggccgtcaggggaggatgctgttc
ccaccctgtctgttactttaataatccacaaatgtgtcgt
ggaagacgctga
tgctccaggaccctctgaaccacgacgt
Sequence translation ASDGRNAAADDKASDLVALAVRGGCCSHPVCYFNNPQMCR
GRR-

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded Cr1.6 precursor

External links
Ncbi
GenBank FJ868072

Tools