Conus stercusmuscarum isolate SmVIIIA superfamily conotoxin gene, complete cds. (N01716) Nucleic Acid Card

General Information
Name Conus stercusmuscarum isolate SmVIIIA superfamily conotoxin gene, complete cds.
Organism Conus stercusmuscarum
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttggcaaccactg
tcgtttccatcccttcagatcgtgcatctgatggcaggaa
tgccgaagtcaacgagagagcgccttggctggtcccttcg
acaatcacgacttgctgtggatatgatccggggtcaatgt
gccctccttgcatgtgcaataatacctgtaaaccaaaacc
caaaaaatcaggccgcagaaaccactga
tgctccaggacc
ctctgaaccacgacgttcgagca
Sequence translation MFTVFLLVVLATTVVSIPSDRASDGRNAEVNERAPWLVPS
TITTCCGYDPGSMCPPCMCNNTCKPKPKKSGRRNH-

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded SmIVB precursor

External links
Ncbi
GenBank FJ868097

Tools