Conus striolatus isolate Sx4.1 superfamily conotoxin gene, complete cds. (N01727) Nucleic Acid Card

General Information
Name Conus striolatus isolate Sx4.1 superfamily conotoxin gene, complete cds.
Organism Conus striolatus
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttggcaaccactg
tcgtttccatcccttcagatcgtgcatatgatggcaagaa
tgccgcagtccacgagagacaatcttggctggtcccttcg
acaatcacgacttgctgtggttatagtccggggacaatgt
gccctccttgcatgtgcactaatacctgctaa
aaaaatgg
ctgatgctccaggaccctctgaaccacgacgt
Sequence translation MFTVFLLVVLATTVVSIPSDRAYDGKNAAVHERQSWLVPS
TITTCCGYSPGTMCPPCMCTNTC-

References
Puillandre,N. and Olivera,B.M. (2010) Evolution of Conus Peptide Genes: Duplication and Positive Selection in the A-Superfamily. J Mol Evol

Internal links
Proteins Encoded Sx4.1 precursor

External links
Ncbi
GenBank FJ868108

Tools