GII precursor mRNA, partial cds (N01838) Nucleic Acid Card

General Information
Name GII precursor mRNA, partial cds
Organism Conus geographus (Geography cone)
Organism Diet piscivorous
Organism Clade II
Organism Region Indo-Pacific
Notes

Sequence
ggatcc
atgttcaccgtgtttctgttggtggtcttggcaa
ccactgtcgtttccttcccttcagaacgtgcatctgatgg
cagggatgacacagccaaagacgaagggtctgacatggac
aaattggtcgagaaaaaagaatgttgccatcctgcctgtg
gcaaacacttcagttgtggacgc
Sequence translation MFTVFLLVVLATTVVSFPSERASDGRDDTAKDEGSDMDKL
VEKKECCHPACGKHFSCGR

References

Internal links
Proteins Encoded GII precursor

External links
Ncbi
GenBank GQ981398

Tools