MrIIIF mRNA, complete cds. (N01878) Nucleic Acid Card

General Information
Name MrIIIF mRNA, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes This sequence was published in NCBI under the name Mr3.9, which was already used by another conotoxin.

Sequence
ccaagagcagacagcgacagcaactggaagaagggtggag
agaggttcgtg
atgttgaaaatgggagtagtgctattcat
cgttctggtcctgtttcccctggcaacactgcagctggat
gcagataaacctgtagaacgatatgcggagaacaaacagc
tcctcaacccagatgaaagaaggggaatcatattgcatgc
tctggggcagcgagtatgctgtcctttcggaggctgccat
gaactttgtctatgctgcgacggttag
cgccgaacatcca
tggcgctgtgctgggcggttttatccaacaatgtcagcgt
ttgttgatttcacgtatcattgcgcccacgtctcttatct
aaaaatgacgaatatgattgcactctggttcagatttcgt
gttcttttctgacaataaatgacaaaactccaaaaaaaaa
aaaaaaaaaaaaaaaaa
Sequence translation MLKMGVVLFIVLVLFPLATLQLDADKPVERYAENKQLLNP
DERRGIILHALGQRVCCPFGGCHELCLCCDG-

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Proteins Encoded MrIIIF precursor

External links
Ncbi
GenBank AB850749 (partial), JF322916

Tools