MrVIA (Mr6.5) mRNA, complete cds. (N01879) Nucleic Acid Card

General Information
Name MrVIA (Mr6.5) mRNA, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
cttgcacggtgaattcggcttcatatttctccactgtctt
ccttggcatcacccaaaacatcaccaag
atgaaactgacg
tgcatgatgatcgttgctgtgctgttcttgacagcctgga
cgctcgtcatggctgatgactccaacaatggactggcgaa
tcatttttcgaaatcacgtgacgaaatggaggaccccgaa
gcttctaaattggagaaaagggcgtgccgcaaaaaatggg
aatattgtatagtaccgatcattggattcatatattgctg
ccctggcttaatctgtggtcctttcgtctgcgtttga
tag
ggatgtcttctactcccatctgtgctacccctggcttgat
ctttgataggcgtgtgcccttcactggttatgaactcctc
tgatcctactctctggatgcctcgggggtccaacatccaa
ataaagtgacatcccaataaaaaaaaaaaaaaaaa
Sequence translation MKLTCMMIVAVLFLTAWTLVMADDSNNGLANHFSKSRDEM
EDPEASKLEKRACRKKWEYCIVPIIGFIYCCPGLICGPFV
CV-

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Proteins Encoded MrVIA precursor

External links
Ncbi
GenBank AB850838 (partial), JF322917, AB850828 (partial)

Tools