Conus eburneus conotoxin Eb14.1 mRNA, complete cds. (N01885) Nucleic Acid Card

General Information
Name Conus eburneus conotoxin Eb14.1 mRNA, complete cds.
Organism Conus eburneus
Organism Diet generalist
Organism Clade
Organism Region
Notes

Sequence
ctcagagcctctctggtgtgcaaacgttgtctcctgccct
cttgtctcccagatcgggtggttctgtgtgcacagctgtc
ttctccacgaagctttccacaggatatccctctgtcgtta
tcggcgagcgcc
atgacgtctgttcagtctgtgacctgct
gctgcctgctgtggctgatgctctctctcactctcgtcac
tcctggatcccctggacctgcacagctgcctgggcatcgc
gctgctagagttcctgcagagccgatattggaagagatat
gccctgacatgtgcaacagtggagaaggggagatcttttg
cacctgcggatcaagacagttcgtggttactctaccggtc
atagagcgaaaaagatcgatggcggtgtga
atgcctactc
accacttctgatgacggcagacaccattcgctgggactga
aagcctctcttcaacgatcttctatggcctagcattgtca
gtccaaaaaatatcccaatactcccagagtctgcaaaagt
cttgtgatgccctatatgtactcaagtgtatggcttggta
caccgtgtcatgttaccctgtatatcctcaagtgtatgtc
ttgatgttccacccacaattcgcttccccatataatgata
ggtctacgccttgatatcccatggccttagtatatgtcct
gataccccacatgtccttcattctgtctcctaaatgcctc
atacctttgtgattaaaatatgaagagagcaacaatatac
aataaacaagcacaaaaaaaa
Sequence translation MTSVQSVTCCCLLWLMLSLTLVTPGSPGPAQLPGHRAARV
PAEPILEEICPDMCNSGEGEIFCTCGSRQFVVTLPVIERK
RSMAV-

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Proteins Encoded Eu14.1 precursor

External links
Ncbi
GenBank HQ897691

Tools