Eu1.6 precursor, mRNA, complete cds. (N01899) Nucleic Acid Card

General Information
Name Eu1.6 precursor, mRNA, complete cds.
Organism Conus eburneus
Organism Diet generalist
Organism Clade
Organism Region
Notes

Sequence
atgggcatgcggatgatgttcaccgtgtttctgttggttg
tcttggcaaccaccgtcgtttctttcacttcagatcgtgc
acctgatggcaggaatgccgcagctaaagcgtttggcctg
atcactccgaccgtcaggaaaggatgttgttccaatcctg
cctgtatgttgaaaaatccaaacctatgttga
Sequence translation MGMRMMFTVFLLVVLATTVVSFTSDRAPDGRNAAAKAFGL
ITPTVRKGCCSNPACMLKNPNLC-

References

Internal links
Proteins Encoded Eu1.6 precursor

External links
Ncbi
GenBank HQ446467

Tools