Conus eburneus conotoxin Eb3.2 mRNA, complete cds. (N01900) Nucleic Acid Card

General Information
Name Conus eburneus conotoxin Eb3.2 mRNA, complete cds.
Organism Conus eburneus
Organism Diet generalist
Organism Clade
Organism Region
Notes

Sequence
atgatgtctaaactgggagtcttgttgaccatctgcctgc
ttctgtttccccttactgctgttcagctggatggagatca
acctgcagacctacctgcattgcgtgcgcaggactttgca
cctgagcgtagtccctggtttgatcccgtcaaacggtgct
gctcgcaggattgctgggtatgcatcccttgttgcccaaa
ttga
Sequence translation MMSKLGVLLTICLLLFPLTAVQLDGDQPADLPALRAQDFA
PERSPWFDPVKRCCSQDCWVCIPCCPN-

References

Internal links
Proteins Encoded Eu3.2 precursor

External links
Ncbi
GenBank HQ857539

Tools