Conus marmoreus conotoxin Mr3.10 mRNA, complete cds. (N01912) Nucleic Acid Card

General Information
Name Conus marmoreus conotoxin Mr3.10 mRNA, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaactgggagtcttgttgaccatctgcctgc
ttctgtttccccttactgctcttccgatggatggagatca
acctgcagaccgacctgcagagcgtatgcagaacgacatt
tcatctgaacgtcatcccttttttgatcgcagcaaacagt
gttgccatctggcggcatgccgcttcagatgtacgccttg
ttgttggtga
Sequence translation MMSKLGVLLTICLLLFPLTALPMDGDQPADRPAERMQNDI
SSERHPFFDRSKQCCHLAACRFRCTPCCW-

References

Internal links
Proteins Encoded Mr3.10 precursor

External links
Ncbi
GenBank HQ857551

Tools