Conus imperialis conotoxin Im1.8 mRNA, complete cds. (N01921) Nucleic Acid Card

General Information
Name Conus imperialis conotoxin Im1.8 mRNA, complete cds.
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
gacggacgtgaaacaccatcaccagcaagtggggatagta
taagacgcagaacaaggaagcagagagtctgagaaaataa
cc
atgggcatgcgtatgatgttcaccgtgtttctgttggt
tgtcttggcaactgctgttcttccagtcactttagatcgt
gcatctgatggaaggaatgcagcagccaacgccaaaacgg
ctcgcctgatcgcgccattcatcagggattattgctgtcc
tagaggtccctgtatggtatggtgtggttga
agccgctgc
tgctccaggaccctctgaaccacgacatgtcgccctccat
ctgacctgcatcattttccgtttctttgtgccactagaac
tgaacaactcgatccactagatacccatgttacctccata
ttctgcaaatacttggttttgattatctttaatttctagt
tacccttgctggtattacatcgtccaaaatttaaacaaaa
a
Sequence translation MGMRMMFTVFLLVVLATAVLPVTLDRASDGRNAAANAKTA
RLIAPFIRDYCCPRGPCMVWCG-

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Proteins Encoded Im1.8 precursor

External links
Ncbi
GenBank JF460787

Tools