Conus imperialis conotoxin Im9.12 mRNA, complete cds. (N01922) Nucleic Acid Card

General Information
Name Conus imperialis conotoxin Im9.12 mRNA, complete cds.
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
gttgagtctccacattggttctcttcacatcttggccgat
tactcagaaaggaaacacagcggttaaa
atgcatctgtca
ctggcaagctcagctgttttgatgttgctgctgctgtttg
ccttgggcaacttcgttggggtccagccaggacagataac
aagagatgcggacaacctccgtaacctgcgatcgcagtgg
aaaaaaaggggtctcttcaagtcacttgataaacgaacga
actgtgaggcacacagctgtagtccctcttgccctgatga
atgttattgcgatactaacgaagacacttgccacccagag
aggcgtggacattag
agattagagagtttcttcgtgaaca
tgatgtcgcaccacagctctgctctgcagcgtgtacatcg
accagtcgacgcatcttttatttctttgtctgtttgattt
gttttcgtgtgttcgtaacacacagagcccgtctatttct
tttactgctctacacttagcctgacaaccagaaagtccag
tgctggggtaaccttaagagtttcgtcacgtgtagcgaat
tccccactttgagtggcaatagtttttccctcaagctgat
ttagtttcaagagttccaccatcaaggtttgtgttttcat
ctgtaactttaggttagtttgtctaaagagaagagacaac
gctaaacaaaaa
Sequence translation MHLSLASSAVLMLLLLFALGNFVGVQPGQITRDADNLRNL
RSQWKKRGLFKSLDKRTNCEAHSCSPSCPDECYCDTNEDT
CHPERRGH-

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Proteins Encoded Im9.12 precursor

External links
Ncbi
GenBank JF460788

Tools