Conus eburneus conotoxin Eb6.6 mRNA, complete cds. (N01925) Nucleic Acid Card

General Information
Name Conus eburneus conotoxin Eb6.6 mRNA, complete cds.
Organism Conus eburneus
Organism Diet generalist
Organism Clade
Organism Region
Notes

Sequence
tccccttcagtgttgaccaacagctgtgtcaccagcccaa
acctttcaactcactacgtggcagttgcagttttcagtgt
gtggacaggattgaacaaaattcagg
atgtcaggattggg
gatcatggtgctaacccttctacttctggtgttcatggca
accagtcatcagcacagaggagggaaacagctgatgcttc
gcaacaatctccaaaagagaacctgcagttctccttcaaa
ttgccccacgggtcaagaatgctgccccgacaaagtggac
gaacccgaggggttctgtgctgacgagtgcattatcacct
ag
tgtttcagacaaagtgaccctggtcatcgctctccatc
atctctttgaaaacaacaacgtgtcaagatcgtttgtttg
tgataaagaggagtatcactggcagagttcacttagagat
ctcgaatggaaaacaagattatttagtaagttgggggggg
Sequence translation MSGLGIMVLTLLLLVFMATSHQHRGGKQLMLRNNLQKRTC
SSPSNCPTGQECCPDKVDEPEGFCADECIIT-

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Proteins Encoded Eu6.6 precursor

External links
Ncbi
GenBank JF499916

Tools