Conus varius M superfamily MMSK group conopeptide Vr+Ts3-IP08 mRNA, complete cds. (N02124) Nucleic Acid Card

General Information
Name Conus varius M superfamily MMSK group conopeptide Vr+Ts3-IP08 mRNA, complete cds.
Organism Conus varius
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgatgtctaaactgggagtcttgttgaccatctgcctgc
ttctgtttccccttactgctgttcagcttgatggagatca
acctgcagacctacctgaattgcgtgcgcaggactttgca
cctgagcgtagtccctggtttgatcccgtcagacggtgct
gctcgcaggattgcagtgtatgcatcccttgttgcccaaa
t
tga
Sequence translation MMSKLGVLLTICLLLFPLTAVQLDGDQPADLPELRAQDFA
PERSPWFDPVRRCCSQDCSVCIPCCPN

References

Internal links
Proteins Encoded Vr3-IP08 precursor

External links
Ncbi
GenBank JF510862

Tools