Conus pennaceus clone PnMLKMF01 conotoxin scaffold III/IV precursor, mRNA, partial sequence (N00230) Nucleic Acid Card

General Information
Name Conus pennaceus clone PnMLKMF01 conotoxin scaffold III/IV precursor, mRNA, partial sequence
Organism Conus pennaceus
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
a
gacgataacccaggtggagcgagtggaaagttcatgaat
gttctgaaagggcagccattatgctgtccttttggaggct
gccacgaactttgtcactgctgcggcagt
tagcgccgaac
atccatggcgctgtgctaggcagttttatccaacaacgac
agcgtttgttgatttcaygtatcattgcgcccacgtctct
tgtctaaaaatgacgaacatgattgcactctggttcagat
ttcgtgttcttttctgacaataaatgacaaaactccctca
aaaaaaaaaaaaaaaaa
Sequence translation DDNPGGASGKFMNVLKGQPLCCPFGGCHELCHCCGS

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Pn3.4 precursor

External links
Ncbi
GenBank AF215130

Tools