Mr14.1 mRNA, complete cds. (N02316) Nucleic Acid Card

General Information
Name Mr14.1 mRNA, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgccgtctgttcggtctgtgacctgctgctgtctgctgt
ggatgatgttctctgtacagctcgtcaatccaggctcccc
tggaactgcacagctgtctaggcatcgcactgctagagtt
cctgcagagcctattctggaaataatatgccccgagatgt
gcgacgagggcgtcggggaagaacccttctgccactgcac
agaaaaacgggacgcggtctcttcacggatcagaaggaga
aaaagatccacggcggtg
tgactgcgcactcacacttccg
atgacgcaggcaccattcgctgggactgaaaatctctctt
caaagatcttctctggcctagcattgtcagtccaaaaata
tcccaatactcccagagtctgcaaagtcgtaatgccctgt
atgtactcagtgtatggcttggtacaccatccatgtctta
ataccccataggtctctctcgtgttaccctatgcatcctc
aagtctgtgtcttgattttccacctataattcgcttcccc
atataatgataggtctacgcattgatactccatgtcatta
gtgtatgtcctgataccccatatgtccttcattctatttc
ctgatgcctcatgcctttctgattaaagtatgaagagagc
aaaaaaaagaaaaaaaaaaaaaaa
Sequence translation MPSVRSVTCCCLLWMMFSVQLVNPGSPGTAQLSRHRTARV
PAEPILEIICPEMCDEGVGEEPFCHCTEKRDAVSSRIRRR
KRSTAV

References

Internal links
Proteins Encoded Mr14.1 precursor

External links
Ncbi
GenBank JX000408

Tools