Eb14.3 mRNA, complete cds. (N02324) Nucleic Acid Card

General Information
Name Eb14.3 mRNA, complete cds.
Organism Conus eburneus
Organism Diet generalist
Organism Clade
Organism Region
Notes

Sequence
atgccgtctgttcggtctgtgacctgctgctgtctgctgt
ggatgatgttctctctcactctcgtcactcctggttcccc
tggacctgcacagctgcctgggcatcgcgctgctagagtt
cctgcagagcagatgatggaagagctatgccctgacatgt
gcaacaggggagaaggggagatcatttgcacctgcgtatt
aggacggcacgtggtttctccatcgatcagagggcgaaaa
agatcgatggcggtg
tgaatgcatactcacacttctgatg
acggcagacaccattcgctgggactgaaagcctctcttca
acgatcttctatggcctagcattgtcagtccaaaaaatat
cccaatactcccagagtctgcaaaagtcttgtgatgccct
atatgtactcaagtgtatggcttggtacaccgtgtcatgt
taccctgtatatcttcaagtgtatgtcttgatgttccacc
cacaattcgcttccccatataatgataggtctacgccttg
atatcccatggccttagtatatgtcctgataccccacatg
tccttcattctgtctcctaaatgcctcatacctttgtgat
taaaatatgaagagagcaaaaaaaaaaaaaa
Sequence translation MPSVRSVTCCCLLWMMFSLTLVTPGSPGPAQLPGHRAARV
PAEQMMEELCPDMCNRGEGEIICTCVLGRHVVSPSIRGRK
RSMAV

References

Internal links
Proteins Encoded Eu14.3 precursor

External links
Ncbi
GenBank JX000416

Tools