Conus distans conotoxin Di1.2 mRNA, complete cds. (N02328) Nucleic Acid Card

General Information
Name Conus distans conotoxin Di1.2 mRNA, complete cds.
Organism Conus distans
Organism Diet vermivorous
Organism Clade Early
Organism Region Indo-Pacific
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttggcaaccactg
tcgtttccttcacttcagatcgtgcattcaattacaagaa
ttacagaacatctaaacggaaagtttctgaggagttgaat
gaatgctgtagaattcctccttgtcttctggatcatgctg
atgaatgtgaaagt
tgaggatgttgcagcagccctcgact
tcagacggttgccttgtcgcccgccctctgagtgaccttc
acctccgtctcttttatccctctgcagctagacagctcta
tagcgaactgcgtcttcagctgtgtgtcgagttctatttt
tctttttcctttcacaagcgcgtactcagaggaatgtcct
ggcacgcttaaatgtttcagacatttatcagcctccttct
tctttttcttcttatggcttgtggattgtagtgccgctta
tttcgtctcaaaatcattaaattctgcttcgatttgagtt
ttgttgaattatagcgatgcttggaaatgccagatcatcc
ttagaaaaggaaaaaaggggaaaagtttgaggtcagtttt
agggggaaagagagagatagaaaaaaatggaaggtacgga
accttggaaaatagacaaagacaaaacagaaaaaaaaatc
aaaactttttttttccttattgtagttgtttgccttcttg
ttctccttaaaaaaagagagagagagagaaaaaaaaaaaa
aaaaaa
Sequence translation MFTVFLLVVLATTVVSFTSDRAFNYKNYRTSKRKVSEELN
ECCRIPPCLLDHADECES

References

Internal links
Proteins Encoded Di1.2 precursor

External links
Ncbi
GenBank JX000420

Tools