Conomarphin-Mr1 mRNA, complete cds. (N02344) Nucleic Acid Card

General Information
Name Conomarphin-Mr1 mRNA, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgtctaaactgggagtcgtgttgtgcatctttctggttc
tgtttcccatggcaactcttcagctggatggagatcaaac
cgctgatcgtcatgcagaccaaaggggccaggacctaaca
gaacagcaacgaaactcgaagcgtgttctgaagaaaaggg
attgggaataccatgcacatccaaaacccaatagcttctg
gacgcttgtt
tgagaggcatcaggctggttattccagaac
agtggtcgtctaatgattgaattaaaagttcactacaggg
aataaaagtttcccaagaaaaaaaaaaaaaaaaaaaaaaa
aaaaaaaaaaaaaaa
Sequence translation MSKLGVVLCIFLVLFPMATLQLDGDQTADRHADQRGQDLT
EQQRNSKRVLKKRDWEYHAHPKPNSFWTLV

References

Internal links
Proteins Encoded conomarphin-Mr1 precursor

External links
Ncbi
GenBank JX000456

Tools