Conus eburneus conotoxin Eb6.2 mRNA, complete cds. (N02353) Nucleic Acid Card

General Information
Name Conus eburneus conotoxin Eb6.2 mRNA, complete cds.
Organism Conus eburneus
Organism Diet generalist
Organism Clade
Organism Region
Notes

Sequence
atgaaactgacgtgtatggtgatcatcgccgtgctgttcc
tgatggccaatcagctcattacagctgattactccagaga
tgagcaggtataccgtgcagtgaggttgagagacgcaatg
cagaaatctaaaggttccgggtcgtgcgcggacctaagtg
aagcttgtgatattctcctttgctgccctggtctgaagtg
caatgaggactttatacccatatgtctc
tgaaattagcct
ggcatctgatatttccccactgtgttctaccctcttttgc
cggattcatccttacctatgtgtggtcatgaaccactcag
tacctacacctttggtggcttcaccggacgtatatcaaaa
taaaaccacattgcaaaaaaaaaaaaaaa
Sequence translation MKLTCMVIIAVLFLMANQLITADYSRDEQVYRAVRLRDAM
QKSKGSGSCADLSEACDILLCCPGLKCNEDFIPICL

References

Internal links
Proteins Encoded Eu6.2 precursor

External links
Ncbi
GenBank JX000431

Tools