Im6.2 mRNA, complete cds. (N02361) Nucleic Acid Card

General Information
Name Im6.2 mRNA, complete cds.
Organism Conus imperialis
Organism Diet vermivorous
Organism Clade XVII
Organism Region Indo-Pacific
Notes

Sequence
atggagaaactgacaatcctgcttcttgttgctgctctac
tggtgttgacccaggctcggactgaacgtcgtagagtaaa
atcgcgaaagacaagcagtacctatgatgacgaaatggca
acgttttgttggtcttattggaatgaatttcaatattcat
atccatatacatatgtacaaccatgccttactttgggcaa
ggcttgtacgacgaactcggattgttgttccaagtactgt
aacaccaagatgtgcaagattaattgggaggga
tgaacca
caaaccatacgacatcaccactcttctcttcagaggcttc
aaaggcttttgttctccgtttgaagaatttttacgagtaa
acaaaaatgtagactagcacgtttttttcctttgcaaaat
caatgatggaggtaaaaagcctcctattttgtcttcatca
ataaagaaattatcatcaaaaaaaaaaaaaa
Sequence translation MEKLTILLLVAALLVLTQARTERRRVKSRKTSSTYDDEMA
TFCWSYWNEFQYSYPYTYVQPCLTLGKACTTNSDCCSKYC
NTKMCKINWEG

References

Internal links
Proteins Encoded Im6.2 precursor

External links
Ncbi
GenBank JX000439

Tools