Conus lividus A superfamily conotoxin Lv1.9 precursor, mRNA, complete cds. (N02407) Nucleic Acid Card

General Information
Name Conus lividus A superfamily conotoxin Lv1.9 precursor, mRNA, complete cds.
Organism Conus lividus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
atgggcatgcggatgatgttaacagtgtttctgttggttg
tcttggcaaccactgtggtttccgatcatgcatctgatgg
caggaataccgcagccaaagtcaaatattctaaaacgcag
gaggaatgctgtcccaatcctccctgtttcgcggtaaatt
cggctctttgtggcgcaagacgttga
Sequence translation MGMRMMLTVFLLVVLATTVVSDHASDGRNTAAKVKYSKTQ
EECCPNPPCFAVNSALCGARR-

References

Internal links
Proteins Encoded Lv1.9 precursor

External links
Ncbi
GenBank JX293420

Tools