Conus rattus XV conotoxin Rt15b precursor, mRNA, complete cds. (N02445) Nucleic Acid Card

General Information
Name Conus rattus XV conotoxin Rt15b precursor, mRNA, complete cds.
Organism Conus rattus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atggagaaacttacagtcctgattcttgttgccactgtcc
tgttgacgatccaggtcctgggtcaaagtgatagagataa
acatctgaagaggaggcccagacaatacgcaaccaaacgt
ctctcggcactcatgaaggggcaccgtcaatgcacaggtg
cggggttcgaatgtgaggagacccccgaatgttgcccgaa
tcttacgtgcaaatgctctggcagtccactttgcactcgt
tatagatgtaaaaca
taatgacctcatgtcacctcatatc
aatacatcagagccacaacc
Sequence translation MEKLTVLILVATVLLTIQVLGQSDRDKHLKRRPRQYATKR
LSALMKGHRQCTGAGFECEETPECCPNLTCKCSGSPLCTR
YRCKT

References

Internal links
Proteins Encoded Rt15b precursor

External links
Ncbi
GenBank JX293460

Tools