Conus varius XV conotoxin Vr15b precursor, mRNA, complete cds. (N02450) Nucleic Acid Card

General Information
Name Conus varius XV conotoxin Vr15b precursor, mRNA, complete cds.
Organism Conus varius
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atggagaaacttacaatcctggttcttgttgccactgtcc
tgttggcgatccaggtcctggttcaaagtgatagagaaaa
acctctgaagggaagggtcaaacaatacgcagcgaaacgt
ctctcggcactcatgagagggccacgccaatgcacaccta
agaatcagatctgtgaggaggatggggagtgttgcccaaa
tcttgagtgtaaatgctttaccagacctgattgccagtcc
ggttataaatgtagacct
tgatgacctcgtgccaccccat
atcaatacatcagagccacaacc
Sequence translation MEKLTILVLVATVLLAIQVLVQSDREKPLKGRVKQYAAKR
LSALMRGPRQCTPKNQICEEDGECCPNLECKCFTRPDCQS
GYKCRP

References

Internal links
Proteins Encoded Vr15b precursor

External links
Ncbi
GenBank JX293465

Tools