Conus marmoreus mRNA for conomarphin_Mr2_precursor, complete cds. (N02565) Nucleic Acid Card

General Information
Name Conus marmoreus mRNA for conomarphin_Mr2_precursor, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgtctaaactgggagtcgtgttgtgcatctttctggttc
tgtttcccatggcaactcttcagctggatggagatcaaac
cgctgatcgtcatgcagaccaaaggggccaggacctaaca
gaacagcatcaaaacttgaagcgtgttctgaagaaaaggg
attgggtaaaccatgcacatccacaacccaatagcatctg
gtcgcttgtttga
Sequence translation MSKLGVVLCIFLVLFPMATLQLDGDQTADRHADQRGQDLT
EQHQNLKRVLKKRDWVNHAHPQPNSIWSLV-

References

Internal links
Proteins Encoded conomarphin-Mr2 precursor

External links
Ncbi
GenBank AB850860

Tools