Conus geographus alpha-conotoxin GIC precursor, gene, partial cds (N00284) Nucleic Acid Card

General Information

Name	Conus geographus alpha-conotoxin GIC precursor, gene, partial cds
Organism	Conus geographus (Geography cone)
Organism Diet	piscivorous
Organism Clade	II
Organism Region	Indo-Pacific
Notes

Sequence

tctgatggcaggaatgacgcagccaaagcgtttgacctga tatcttcgaccgtcaagaaaggatgctgttcccatcctgc ctgtgcggggaataatcaacatatttgtggccgaagacgc tgatgctccaggaccctctgaaccacgacgt
Sequence translation	SDGRNDAAKAFDLISSTVKKGCCSHPACAGNNQHICGRRR

References

McIntosh,J.M., Dowell,C., Watkins,M., Garrett,J.E., Yoshikami,D. and Olivera,B.M. (2002) Alpha-conotoxin GIC from Conus geographus, a novel peptide antagonist of nicotinic acetylcholine receptors J. Biol. Chem. 277:33610-33615

Internal links

Proteins Encoded

GIC precursor

External links

Ncbi
GenBank	AF526267

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Wednesday 29 March 2023