Conus vexillum conotoxin scaffold VI/VII precursor (C11GB) gene, complete cds (N00287) Nucleic Acid Card

General Information
Name Conus vexillum conotoxin scaffold VI/VII precursor (C11GB) gene, complete cds
Organism Conus vexillum
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgtgtgatgatcgttgctgtgctgttct
tgaccgcctggacagtcgtcacggctgagcctcactccag
caatgtattggaaaatctttatctgaaggcacatcacgaa
atggaaaaccccgaagcctctaaattgaacacgagagacc
gttgccagagagcaaacttcgtgtgcgatgccttccatca
tgcagccgtctgctgtgaaggcgtatgtgtactagtctgc
gcgtgg
taa
Sequence translation MKLTCVMIVAVLFLTAWTVVTAEPHSSNVLENLYLKAHHE
MENPEASKLNTRDRCQRANFVCDAFHHAAVCCEGVCVLVC
AW

References
Luo,S., Zhang,B. and Zhangsun,D. (0) C11GB conotoxin scaffold VI/VII precursor

Internal links
Proteins Encoded A11GB precursor

External links
Ncbi
GenBank AY316160

Tools