Lt1.3 (N02942) Nucleic Acid Card

General Information
Name Lt1.3
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
GTGGTTCTGGGTCCAGCA
TTTGATGGCCGGAATGCTGCAC
CCAGCGACAAAGCGTCTGACCTGATCTCTCTGGCCGTCAG
GGGATGCTGTTCCCATCCTGCCTGTAGTGGGAATAATCCA
TACTTTTGTGGTGGAAAACGC
TGATACTCCATGACCCTCT
GAACCACGAC
Sequence translation FDGRNAAPSDKASDLISLAVRGCCSHPACSGNNPYFCGGK
R

References
Chen J, Liang L, Ning H, Cai F, Liu Z, Zhang L, Zhou L, Dai Q (2018) Cloning, Synthesis and Functional Characterization of a Novel α-Conotoxin Lt1.3 Marine drugs 16:112

Internal links
Proteins Encoded Lt1.3 precursor

External links
Ncbi
GenBank KF414121.1

Tools