Conodipine-P6 precursor (N02958) Nucleic Acid Card

General Information
Name Conodipine-P6 precursor
Organism Conus purpurascens
Organism Diet piscivorous
Organism Clade III
Organism Region Eastern Pacific
Notes

Sequence
atgaagctgctggcccccgtgctgtgggccatggccgccc
tgggcgtgacctggctggtggccgtggacagcaaggagag
ctgcaccaagcacagcaacggctgcagcacccccctgagg
ctgccctgccaggagtacttcaggcccgcctgcgacatcc
acgacaactgctaccactgcggcaagaccttcggcatcag
cagggaggagtgcgacaaggccttcctgaaggacatgaac
accctgtgcaagaagctgggcagcaacttcgccacctgcc
ccgccaggggcaagagggaggtgaccagccacagggccac
cagcatcgcccacagcaggctgtggaagaccgccctggac
cagaagagcttcctgaacaggaaggccaggcaggtgttct
tcctgctgcccaccacctgccagggctgggccaagaacta
ccacctggccgtgaagctggccggcgccaacagctacagc
gtgaccaccgacctggagacctgccagggcctggagcact
gcctgcccaaccac
Sequence translation MKLLAPVLWAMAALGVTWLVAVDSKESCTKHSNGCSTPLR
LPCQEYFRPACDIHDNCYHCGKTFGISREECDKAFLKDMN
TLCKKLGSNFATCPARGKREVTSHRATSIAHSRLWKTALD
QKSFLNRKARQVFFLLPTTCQGWAKNYHLAVKLAGANSYS
VTTDLETCQGLEHCLPNH

References
Möller, C., Davis, W.C., Clark, E., DeCaprio, A. and Mari, F. (2019) Conodipine-P1-3, the First Phospholipases A2 Characterized from Injected Cone Snail Venom Molecular & Cellular Proteomics 18:876-891

Internal links
Proteins Encoded Conodipine-P6 precursor

External links
Ncbi
GenBank MK493032

Tools